SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000014256 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000014256
Domain Number 1 Region: 514-645
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-24
Family YWTD domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 255-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000103
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 3 Region: 122-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 39-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 5 Region: 221-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000103
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 6 Region: 4-39
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 7 Region: 163-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 301-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 9 Region: 337-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000729
Family EGF-type module 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000014256
Domain Number - Region: 385-437
Classification Level Classification E-value
Superfamily YWTD domain 0.00131
Family YWTD domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000014256   Gene: ENSDNOG00000018360   Transcript: ENSDNOT00000018364
Sequence length 922
Comment pep:novel genescaffold:dasNov2:GeneScaffold_4624:62958:150129:-1 gene:ENSDNOG00000018360 transcript:ENSDNOT00000018364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAKECDEDQFRCRNERCIPSVWRCDEDDDCSDNSDEDDCPKKTCAGNDFTCDNGHCIPER
WKCDGEEECPDGSDESEATCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXCAPHEFQCSNRSCLASVFVCDGDDDCGDGSDERGCADPACGPREFRCGGDGGACIP
ERWVCDRQFDCEDRSDEAAELCGRAGPGTTATATAAPAACAAAAQFACRSGECVHLGWRC
DGDRDCKDKSDEADCPLGTCRGDEFQCGDGSCVPAIKHCNGERDCPDGSDEAGCLQGLNE
CLHNNGGCSHICTDLKIGFECTCPEGFRLLDQKTCGDIDECEDPDACSQICVNYKGYFKC
ECHPGYEMDTLTKNCKAVAGRSPSLIFTNRHEVRRIDLVKRDYSRLIPMLKNVVALDVEV
ATNRIYWCDLSYRKIYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMYWSDWGYQAKIEKSGLNGVDRQTLV
SDNIEWPNGITLDLLAQRLYWVDSKLHQLSSIDFSGGNRKMLISSTDFLSHPFGIAVFED
KVFWTDLENEAIFSANRLNGLEISVLAENLNNPHDIVIFHELKQPRXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVIALCMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHI
GRTAQIGHVYPAAISSFDRPLWAESCLGETRELESPPALKEIFVLPREPRSQLHQLAKNP
LYELPVVQSKRVALSLEDDGLP
Download sequence
Identical sequences 9361.ENSDNOP00000014256 ENSDNOP00000014256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]