SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000014908 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000014908
Domain Number 1 Region: 94-306
Classification Level Classification E-value
Superfamily ARM repeat 1.99e-17
Family HEAT repeat 0.0071
Further Details:      
 
Domain Number 2 Region: 1356-1695,1866-1963
Classification Level Classification E-value
Superfamily ARM repeat 0.0000864
Family B56-like 0.053
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000014908
Domain Number - Region: 18-61
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00392
Family beta-sandwich domain of Sec23/24 0.011
Further Details:      
 
Domain Number - Region: 789-819,884-940,1001-1017,1399-1438
Classification Level Classification E-value
Superfamily ARM repeat 0.00455
Family PBS lyase HEAT-like repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000014908   Gene: ENSDNOG00000019218   Transcript: ENSDNOT00000019225
Sequence length 3117
Comment pep:novel genescaffold:dasNov2:GeneScaffold_6753:125:220282:1 gene:ENSDNOG00000019218 transcript:ENSDNOT00000019225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLEKLMKAFESLKSFQQQQQQQPPPPPPQPPQPAPQAQPPLQAPLQTQPPQSPPTPSG
PAVAEEPLLRPKKELLTTKKDRVNHCLTICENIVAQSLRNSPEFQKLLGIAMELFLLCSD
DAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGASRSLRAALWRFAELAHLV
RPQKCRPYLVNLLPCLTPISKRPEESVQETLAAAIPKVMASFGNFANDNEIKVLLKAFIA
NLKSSSPTVRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGLLVPVEDEHYALLILGVLLT
LRYLVXXXXXXXXXXXXXXXXXXXXXXMVSPSTEQLIQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXKVLLGEEEALEDDSESRSDVSSSAFAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXVLDGAEGQYLGVPPGQLQDEDEEAAGVLPDGASDAFR
SSSLALQQAHLLKSLGHSRQASDSSVDKLVSRDEAAEPGDQENKXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT
GSTFSLVDCIPLLQKTLKDESSVTCKLACTAVRXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLLQERVLSNVVIYLGDED
PRVRHVAAASLTXXXXKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTI
TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGCCEALCLLSTAFPVCV
WSLGWHCGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXAALPSLTNPPSLSPIRRKGKEKEPGEQTSVPLSPKKGNEASPAARQSDPSGPVT
SKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLELQNSTEKFGAFLRSALDVLSQILELA
TLQDIGKCVEEILGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGFSSNPSKSQGR
AQRLGSSSLRPGLYHYCFMAPYTHFTQALADASLRNMVQAEPEHDTSGWFDVLQKVSTQL
KTNLTSVTKTRADKNAIHNHIRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQLRVN
YCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKII
QLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIPY
HQVLEMFILVLQQCHKENEDKWKRLSRQIADMILPMLARQQMHIDSHEALGVLNTLFEIL
APSSLRPVDMLLRSMFVTPSTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQELSF
SPYLISCPIINRLREGGSNSALEEHSEGVQMKHLPEETFSXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFRRITAAATRLFGSDGSDGNFYTLESLNAQ
VHSMMPTHPSLVLLWCQILLLANHTDYRWWSEVQQTPRRHSLSSTKLLSPQMSGEDDDSD
MVSKLGMCNREIVRRGALVLFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFIS
AVHRNSAASGLFIQAIQSRCENLSTPTTLRRTLQCLEGIHLSQSGAVLTLYVDRLLCTPF
RVLARMVDTLACRRVEMLLAANVQSSLSQLPVEELNRIQEYLQSSGLAPRHQRLYSLLDR
FRLSTAPESLSPSPPVTSHPLDGDAQMSPETVNPDGDWYIRLVKSQCWTKSDSALLEGAE
LVNRIPPGELSALMSSPEFNVSLLAPCLSLGVTEISGGRKSHLFETARVVTLDRVTSLVQ
QLPAVHQVFQPFLAMESSAYWSKLNDLYGDAVLYPTLTTLARALAQYLAVLSQLPSHLHL
PPEKERDTVKFVVMTLEALSWHLIHEQVPLSLDLQAGLDCCCSALQLPELWGLISSTDCV
TQACSLIHCVRFILEAIAVQPGDQLLSPERKTNTPKAVGEDEVDAKMLXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXNGSVPAFLTPLKNIVVSLARLPLVNSYTRVPPLVWKLGWSPTP
GGDFRTALPEIPXXXXXXXXXXXXXXXXXXXXXWTSRTQFEETWATLLGVLVTQPIAMEQ
AESQPEEDTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLVVSDLFTERSQFEMMYLTL
TELRRVHPAEDEILVQYLVPAMCKAAAVLGMXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCVNVHSQQHVLVMCATAFYLIENYP
LDVGPEFSASIIQMCGVMLSGSEEATPAVMYHCVLRGLERLLLSEQLSRLDAESLVKLSV
DRVNVQSPHRAMAALGVMLTCMYTGKEKISPGRTSDANPAAPDSESVIVAMERVSVLFDR
IRKGFPCEARVVARILPQFLDDFFPPQDVMNKVIGEFLSNQQPYPQFMASVVFKVFQTLH
GTGQSSMVRDWVMLSLSNFTQRAPVAMAMWSLSCFFVSASTSPWVSATXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRRLLCLLSVHKSAAC
Download sequence
Identical sequences ENSDNOP00000014908 9361.ENSDNOP00000014908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]