SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000015367 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000015367
Domain Number 1 Region: 484-740
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-60
Family YWTD domain 0.000000905
Further Details:      
 
Domain Number 2 Region: 830-1042
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-50
Family YWTD domain 0.00000292
Further Details:      
 
Domain Number 3 Region: 1093-1346
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-47
Family YWTD domain 0.00000297
Further Details:      
 
Domain Number 4 Region: 1398-1606
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-43
Family YWTD domain 0.00000499
Further Details:      
 
Domain Number 5 Region: 307-347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 6 Region: 271-309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000123
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 7 Region: 352-388
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 186-226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 9 Region: 1352-1397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000698
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 10 Region: 401-444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 150-185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 12 Region: 230-268
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 1048-1099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000658
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 432-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 15 Region: 67-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000956
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000015367
Domain Number - Region: 742-779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000243
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000015367   Gene: ENSDNOG00000019816   Transcript: ENSDNOT00000019817
Sequence length 1789
Comment pep:novel genescaffold:dasNov2:GeneScaffold_1977:383:43325:-1 gene:ENSDNOG00000019816 transcript:ENSDNOT00000019817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRPWGALLLGALLYAQAIASRLRVGKGTGTSPSAPSRGGKGGGTPLGSALPGSCCRRAG
GLAGSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRECEEDEFPCQNGYCIRSLWHCDGDNDCGD
NSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEESCPSAVPAPPCSLEEFQ
CAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAGWRCDGDADCD
DRSDERNCTTAMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASDQF
LCGNGRCIGQRKLCNGVNDCGDSSDESPQQNCRPRTGEENCNVNNGGCAQKCQMVRGAVQ
CTCHTGYRLTEDGRTCQDVNECAEEGYCSQGCTNSEGAFQCWCEAGYELRPDRRSCKALG
PEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANL
NGSSVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQNLEKPR
AIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGHRMYWVDA
KHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEII
RNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKISSHACA
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVYWTDVSTDTI
SRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLIWEN
LDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASDRQVIIFSNLTWPNGLAIDYGSQRL
YWADAGMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGERIYWTDWQTKSIQSADRLTGL
DRETLQENLENLMDIHVFHRRRPPVSTPCALENGGCSHLCLRSPNPSGFSCTCPTGINLL
PDGKTCSPGMNSFLIFARRIDVRMVSLDIPYFADVVVPINVTMKNTIAIGVDPQEGKVYW
TDSTLHRISRANLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLDGSM
RKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSDRTVLISNNLGWPNGLT
VDKASSQLLWADAHTERIETADLNGASRHTLVSPVQHPYGLTLLDSYIYWTDWQTRSIHR
ANKGTGSNVILVRSNLPGLMDIQAVDRAQPLGFNKCGSRNGGCSHLCLPRPSGFSCACPT
GIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNVISLDYDSVDG
KVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTDGLAVDWVARNLYWTDTGRNTIEASRL
DGSCRRVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSDRKVLINTDLGWP
NGLTLDYDIRRIYWVDAHLDRIESADLNGKLRQVLVSQVSHPFALTQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNNGGCTHLCFARALDFVC
ACDERDGRPCSLVPGLVPPAPRATSMSEKSPLLPNTLPTTLRSSTTRSRTSQEEVEGRCS
EKDARLGLCAHSNEAIPAAPGEGLHVSYVIGGLLSILLILLVIAALMLY
Download sequence
Identical sequences ENSDNOP00000015367 9361.ENSDNOP00000015367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]