SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000015529 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000015529
Domain Number 1 Region: 1403-1455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000132
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 249-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000121
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 290-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000187
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 1040-1092
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000736
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 1290-1339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000642
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 6 Region: 11-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000043
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 7 Region: 1435-1489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000368
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 8 Region: 67-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000591
Family Plant C2H2 finger (QALGGH zinc finger) 0.077
Further Details:      
 
Domain Number 9 Region: 1103-1151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000945
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number 10 Region: 1015-1052
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000313
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 11 Region: 681-732
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000611
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000015529
Domain Number - Region: 1378-1412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000143
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number - Region: 1173-1220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00132
Family Classic zinc finger, C2H2 0.057
Further Details:      
 
Domain Number - Region: 393-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00169
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 1226-1290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00394
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 332-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00414
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 449-494,590-654
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0314
Family beta-sandwich domain of Sec23/24 0.019
Further Details:      
 
Domain Number - Region: 193-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0377
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000015529   Gene: ENSDNOG00000020013   Transcript: ENSDNOT00000020013
Sequence length 1531
Comment pep:novel genescaffold:dasNov2:GeneScaffold_2716:425977:451472:-1 gene:ENSDNOG00000020013 transcript:ENSDNOT00000020013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVASGAESLFKTHMCPECKRCFKKRTHLVEHLHLHFPDPSLQCPNCQKFFTSKSKLKTHL
LRELGEKAHRCPLCHYSAVERNALNRHMASMHEAISNFYSDIYTCPVCRKEFRLSQALKE
HLKSHTAAAATEPLPLHCFQEGCSYATPDRKAFVKHLKEAHGVRAVECRHHSCPLLFATA
EAMEAHHKSHYAFHCPHCDFACSNKHLFRKHKKQGHPGSEELRCTFCPFATFNPVAYQDH
VGKMHANEKIHQCPECNFATAHKRVLIRHMLLHTGEKPHKCELCDFTCRDVSYLSKHMLT
HSNAKDYMCTECGYVTKWKHYLSVHMRKHAGDLRYQCNQCSYRCHRADQLSSHKLRHQGK
SLMCEVCAFACKRKYELQKHMASQHHPGTPAPLYPCRYCSYQSRHKQALLSHENCKHTRL
REFRCALCDYRTFSNTALFFHKRKAHGYVPGDQVWQLRYASQEPEGARQCPTPPPDSQPS
NQLSGQSEGPGHDQETMVDPSLNQASPETNEENGAGRQDGSEASQRGDLVGSPSPAEVDE
GSCTLHLETLGVELESVAEPPLEEMPETAPMEFRPLELEGPDGFELPSYEGIGPSGLGAE
EEPILEKPVLETPRNVPPSEEPPNSWVETLKATPPAETTSLPQFPESESLLKALRRQDKE
QAEALVLEGRVQMVVIQGEGRAFRCPHCPFITRREKALSLHSRTGCQGRREALLCPECGA
SFKQQRGLSTHLLKKCPVQLRKNKGLPRQDSPIPLHPPPIGNQAXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSCPTCPFSC
QQERFLRTHQARGCPLESGELHCGLCPFTAPAAAALRLHQKRRHPTTAPARSPRPPLQCG
DCGFTCKQSRCLQQHRQLKHEGVKPHQCPFCDFSTTRRYRLEAHQSRHTGVGRIPCSSCP
QTFGTNSKLRLHRLRVHDKTPTHFCPLCDYSGYLRHDITRHVNSCHQGTPAFACPQCEAQ
FSSETALKQHALRRHPEPAPPAPGSPTEATEGPLHCSRCGLLCPSPASLRGHTRKQHPRL
ECGACQEAFPTRPALDEHRRQQHFSHRCQLCDFAARERVGLVKHYLEQHEDTAAAAVASD
GDSGQPPLHCPFCDFACRHQLVLDHHVKGHGGTRLYKCTDCAYSTKNRQKITWHSRIHTG
EKPYRCHLCPYACADPSRLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKPY
QCPECEYCTNRADALRVHRETRHREARAFMCEQCGKAFKTRFLLRTHLRKHSEAKPYVCN
VCHRAFRWAAGLRHHALTHTDRHPFFCRLCSYKAKQKFQVVKHVRRHHPDQADPNQGVGK
DPTTPTVHLHDVQLENPSPPAPAASPTGPEG
Download sequence
Identical sequences 9361.ENSDNOP00000015529 ENSDNOP00000015529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]