SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000015683 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000015683
Domain Number 1 Region: 18-130
Classification Level Classification E-value
Superfamily Cyclin-like 2.2e-34
Family Cyclin 0.000000631
Further Details:      
 
Domain Number 2 Region: 173-263
Classification Level Classification E-value
Superfamily Cyclin-like 7.81e-30
Family Cyclin 0.00000307
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000015683
Domain Number - Region: 264-332
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0392
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000015683   Gene: ENSDNOG00000023960   Transcript: ENSDNOT00000025112
Sequence length 432
Comment pep:novel genescaffold:dasNov2:GeneScaffold_6363:145330:166302:1 gene:ENSDNOG00000023960 transcript:ENSDNOT00000025112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKENKENSSPSVASANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDV
GTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTA
RSLLNDVQFGQFGDDPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKNKIQK
LVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQ
DVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQQAQGPEPS
QPPQKDSQQPAQQQQQAVQQPKKPSPQPSPPRQVKRAVVSGPRWALGLVFCHGGHTTXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKPPLAAALGEAEPPGPVDAGDLPKV
QIPPPAHPVNLH
Download sequence
Identical sequences 9361.ENSDNOP00000015683 ENSDNOP00000015683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]