SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000000750 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000000750
Domain Number 1 Region: 203-380
Classification Level Classification E-value
Superfamily Serpins 1.57e-57
Family Serpins 0.00000784
Further Details:      
 
Domain Number 2 Region: 1-152
Classification Level Classification E-value
Superfamily Serpins 2.75e-35
Family Serpins 0.0000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000000750   Gene: ENSDNOG00000000975   Transcript: ENSDNOT00000000975
Sequence length 380
Comment pep:novel genescaffold:dasNov2:GeneScaffold_5321:4874:58319:1 gene:ENSDNOG00000000975 transcript:ENSDNOT00000000975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLAAANAEFCFNLFRELDSNQGNGNMIFSSLSLFTALALVRLGARGDCAAQLDKVLHF
GADSGRRNSSNTQQPLEYQLNRVLSDINKPHKGYQLSMTNGLFAEKVFDIHRNYIECAKK
LYDANVERVDFTNDIEDTRYKINKWIEHETHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXCPGKAVRMMHQERKFNLSVIQDPPMQVLELKYHGGISMFVL
LPEGDLLQVEKKLNFEVLKDWTNPRKMSSQYVEVFLPRFKIEKNYEIKDYLKALGVKDIF
DESKADLSGIASGGRLYLSKLMHKSYIEVTEEGTEATAATGVDVVEKQLPEFTVFRADHP
FLFVIRKDDLILFSGKVSCP
Download sequence
Identical sequences ENSDNOP00000000750 9361.ENSDNOP00000000750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]