SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000001603 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000001603
Domain Number 1 Region: 1259-1524
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-52
Family YWTD domain 0.000002
Further Details:      
 
Domain Number 2 Region: 3083-3267
Classification Level Classification E-value
Superfamily YWTD domain 1.28e-30
Family YWTD domain 0.0000994
Further Details:      
 
Domain Number 3 Region: 598-764
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-26
Family YWTD domain 0.0000782
Further Details:      
 
Domain Number 4 Region: 1879-2069
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-21
Family YWTD domain 0.0005
Further Details:      
 
Domain Number 5 Region: 3887-4065,4111-4132
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-18
Family YWTD domain 0.00078
Further Details:      
 
Domain Number 6 Region: 3798-3911,4163-4204
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.32e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 7 Region: 2946-3004,3260-3321
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000345
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 8 Region: 339-411
Classification Level Classification E-value
Superfamily YWTD domain 0.000000000034
Family YWTD domain 0.0013
Further Details:      
 
Domain Number 9 Region: 1737-1831
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000366
Family YWTD domain 0.0026
Further Details:      
 
Domain Number 10 Region: 919-959
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000825
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 11 Region: 877-921
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 12 Region: 3349-3389
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 13 Region: 840-880
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 14 Region: 3627-3664
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 15 Region: 3467-3507
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 16 Region: 3549-3584
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 1003-1039
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.00029
Further Details:      
 
Domain Number 18 Region: 3589-3626
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000107
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 19 Region: 2799-2833
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 20 Region: 3311-3346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 21 Region: 2676-2713
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 3506-3546
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000785
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 23 Region: 3670-3707
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 24 Region: 3432-3468
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 3391-3428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 26 Region: 156-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000207
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 27 Region: 2546-2583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 28 Region: 2716-2754
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 29 Region: 1175-1253,1824-1874
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000408
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 30 Region: 2268-2357,2400-2452
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000419
Family YWTD domain 0.0038
Further Details:      
 
Domain Number 31 Region: 2583-2622
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 31-69
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 33 Region: 971-1002
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 34 Region: 2836-2876
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 35 Region: 2637-2672
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000327
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 36 Region: 1133-1169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000038
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 37 Region: 4381-4423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000122
Family EGF-type module 0.048
Further Details:      
 
Domain Number 38 Region: 2769-2792
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000419
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 39 Region: 76-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000419
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 40 Region: 4283-4317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family EGF-type module 0.031
Further Details:      
 
Domain Number 41 Region: 794-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00002
Family EGF-type module 0.019
Further Details:      
 
Domain Number 42 Region: 1535-1584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000255
Family EGF-type module 0.022
Further Details:      
 
Domain Number 43 Region: 1574-1644
Classification Level Classification E-value
Superfamily YWTD domain 0.0000262
Family YWTD domain 0.0042
Further Details:      
 
Domain Number 44 Region: 1107-1131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000969
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000001603
Domain Number - Region: 2464-2505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0681
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000001603   Gene: ENSDNOG00000002063   Transcript: ENSDNOT00000002068
Sequence length 4594
Comment pep:novel genescaffold:dasNov2:GeneScaffold_5528:27751:1467722:-1 gene:ENSDNOG00000002063 transcript:ENSDNOT00000002068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEFLLAVLTLSGLLPIAKVLTVGADRDQQLCDPGEFLCHDHVTCISQSWLCDGDPDCPD
DSDESVDTCPEEIELKCPLNHIACLAANKCVHLSQLCNGILDCSDGYDEGVHCRXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDECAVYGMCSQTCINTHGSYACSC
VEGYVIQPDNKSCKAKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLFFTDYGNVATVERCDMDGMN
RTSIIDSKAEQPAALALDLVNKLVYWVDLYLDSVEVVDYQGKNRHTIIHGRQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSHACEVDPY
GMPGGCSKICLLSSSYKTRPHRCRTGFNLGSDGRSFKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDN
VEGIAVDWIGNNLYWTNDGHRKTINVARLEKASQSRKTLLEGEMSHPRGIVVDPVNGXXX
XXXXXXXXXDDSVGRIEKAWMDGFNRQIFVTSKMLCPNGLTLDFHTNILYWCDAYYDHIE
KVFLNGTHRKIVYSGKELNHPFGLSHHGNYVFWTDYMNGSFQLHLVTSEVTLLRQERPPL
FGLQIYDPRKQQGDNMCRINNGGCSTLCLAIPGGRVCACADNQLLDENGTTCTFNPGEVL
PHICKAGEFRCKNRHCIQARWKCDGDDDCLDGSDEDSENCFNHSCPDDQFKCQNNRCIPK
RWLCDGANDCGSNEDESNQTCAARTCQMDQFSCGNGRCIPRAWLCDREDDCGDESDEMAS
CXXXXXXXXXXXXCKSGRCISSKWHCDSDDDCGDGSDEVGCVHSCLDNQFRCSSGRCIPG
HWACDGDNDCGDFSDETQINCTKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXRCINKAWVCDGDIDCEDQSDEDDCESFLCGPPKY
PCANDTSVCLQPEKLCNGRRDCPDGSDEGDLCDECSLNNGGCSNHCSVVPGKGIVCSCPE
GFQLNTDNKTCEIVDYCSSHLKCSQVCEQHKHTVKCSCYEGWKLEMDGESCTSVDPFEAF
IIFSIRHEIRRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYRGKLSESG
GVSAIEVVVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGSLRTTLIAGDMEHPR
AIALDPRYGILFWTDWDANFPRIESASMSGAERKTIYKDMKTGAWPNGLTVDHFEKRIVW
TDARSDAIYSALYDGTGMMEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSKANKWTGQ
NVSVIQKTSAQPFDLQIYHPSRQPQAPNPCAAHDGKGPCSHMCLINHNRSAACACPHLMK
LSSDKKTCYEMKKFLLYARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFDASEERLY
WTDIKTQTIKRAFINGTGLETVISRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSID
YVENKLYWISSGNGTINRCNLDGGNLEVIESMKEELTKATALTIMDKKLWWADQNLAQLG
TCNKRDGRNPTVLRNKTSGVVHMKVYDKETQQGSNSCQPNNGGCSQLCLPTSETTRTCMC
TEGYYLHKNRMSCQGIESFLMYSVNEGIRGIPLEPSDKTEALMPISGTSFAVGIDFHAEN
DTIYWTDMGFNKISRSKRDQTWKEDIITNGLGRVEGIAIDWIAXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXYLFWTEWGQMPCIGKARLDGSQKVVLVSMGIAW
PNGISIDYEENKLYWCDARTDKIERIDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
AHANGSIRRGHKNDATETVTMRTGLGVNLKEVKIFNRVREKXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGSVEGLAYHRAWD
TLYWTSSTTSSITRHTVDQTRPGAFDREAVITMSEDDHPHVLALDECQNLMFTNWNEQHP
SIMRSTTRKNAHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIVKS
GPGTFLSLAIYGNYIFWSDWGRRAILRSNKYTGGDTKILRSDIPHQPMGIIAVANDTNSC
ELSPCALLNGGCHDLCLLTPNGRVNCSCRGDRILLDDNRCVTKNSSCNIYSEFECGNGEX
XXXXXXXXXXXXXXXXXXXXXXXXXNRSCRRGFKPCYNRRCVPYGKLCDGENDCGDNSDE
LDCKVSTCAAVEFRCADGTCIPRSARCNQNIDCADATDEKSCNNTDCTHFYKLGVKTTGF
IKCNSTSLCVLPTWICDGSNDCGDYSDELKCPVQNKHKCEENYFGCPSGRCILNTWICDG
QNDCEDGLDEVHCDSSCSWNQFACSAQKCISKHWICDGEDDCGDGLDESDSICXXXXXXX
XXXXXXXXHACVPRHWLCDGERDCPNGSDELSTAGCAPNNTCDENAFMCRNKICIPKQFV
CDHDDDCGDGSDESLQCGYRQCNAEEFSCADGRCLLNIQWQCDGDFDCLDRSDEAPLNPK
CRSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXCKCWPGFQLKDDGKTCVDIDECSSGFPCSQQCINTYGTYKCLCTDGYEIQPDN
PNGCKSLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXVVHSTAVPNALAVDWIGKNLYWSDTEKRIIEVSKLSGLYPTI
LVSKRLKFPRDLSLDPQAGYLYWIDCCEYPHIGRVGMDGTNQSVVIETKISRPMALTIDY
VNHRLYWADENHIEFSNMDGSHRHKVPYQDIQGVIALTLFEDYIYWTDGKTKSLSRAHKT
SGADRLSLINSWHAITDIQVYHSYRQPDVSKHLCMINNGGCSHLCLLAPSKTHTCACPTN
FYLAADNRTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPEDCPEFKCQPGRFQ
CGTGLCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNLRCNGQDDCG
DEEDERDCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKKTCGPHEFQC
KNNNCIPDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCANGDCVSSRFWCDGDFDCADG
SDERNCETSCSKGQFQCSNGQCISAKWKCDGHEDCKYGDDEKNCEPASPSCSSSEYICAS
GGCISASLKCNGEYDCADGSDEMDCVTECKEDQFRCKNKAHCIPIRWLCDGIHDCVDGSD
EGNCDKGGNICRADEFLCNNSLCKLHFWVCDGEDDCGDNSDEAPDMCVKFXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXPTEYTCEDNVNPCGDDAYNQIKTSVFCRCKPGFQRNMKNRQCED
LNECLVFGTCSHQCINMEGSYKCVCDQNFQERNSTCIAKGSEDQVLYIANDTDILGFIYP
FNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYRRIHGREKRQANSGLI
CPEFKRPRDIAVDWVAGNIYWTDHSRMHWFSYYTTHWTSLRYSINVGQLNGPNCTRLLTN
TAGEPYAIAVHPRRGMMYWTVIGDHSHIEEAAMDGTLRRILVQKNLQRPTXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLHPHRIDIFEDYIYGAGPKNGVFRVQKFG
HGSVEYLALAIDTKGALISHRYKQLDLPNPCLDLACEFLCLLNPSGATCVCPEGKYLING
TCSDDSLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXRPTCNCALGFTGPNCGKTVCEDFCQNGGTCSVTAGNQPYCHCQPEYTGDRCQYXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCTNG
KIASSCQLCDAYCYNGGTCQLDPETNVPVCLCPANWSGTQCERPAPKSSKSDHISTXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXTKTIRRQPIINGGINVEIGNPSYNMYEVDHDHN
DGGLLDPGFMVDPTKARYIGGGSSVFKLPHTAPHIYLNSDLKGPLTAGPTNYSNPMYAKL
YMDGQNCRNSLGSVDERKELLPKKIEIGIRETVA
Download sequence
Identical sequences 9361.ENSDNOP00000001603 ENSDNOP00000001603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]