SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000004115 from Dasypus novemcinctus 69_2

(show help)
Strong hits

Sequence:	ENSDNOP00000004115
Domain Number 1	Region: 206-261
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.96e-20
Family	Classic zinc finger, C2H2	0.0051
Further Details:

Domain Number 2	Region: 4-64
Classification Level	Classification	E-value
Superfamily	KRAB domain (Kruppel-associated box)	9.55e-17
Family	KRAB domain (Kruppel-associated box)	0.002
Further Details:

Domain Number 3	Region: 168-220
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.00000000000000146
Family	Classic zinc finger, C2H2	0.0068
Further Details:

Domain Number 4	Region: 248-298
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.00000000000000657
Family	Classic zinc finger, C2H2	0.011
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSDNOP00000004115 Gene: ENSDNOG00000005308 Transcript: ENSDNOT00000005308
Sequence length	299
Comment	pep:novel scaffold:dasNov2:scaffold_38564:4443:12266:1 gene:ENSDNOG00000005308 transcript:ENSDNOT00000005308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	VQPPELMNLKDVIIDFTQEEWALLDTSQRKLFRDVMLENIHLISMAPGHQFCKSDALSQL EQGEELWGEGNGFLQSENSGRESCLKKLMLSMQRICRKDTSTVMSLQKSHTQNGITCSEL PEDFTHKSRVSQHMFTQKVKKLYFTVYLEKSLSDKTSSNQKQNHQRRKSYECHVCEKAFC RCFGLRQHERAHTGEKPYKCHVCGKSYAYSSGLRQHERTHTGEKPYECHLCGKAFTISSV LREHEKTHPGEKPNECHVCGEASTFLSDLRKHERSHPGEKPYECLICGKAFTWSSVLRR
Download sequence
Identical sequences	9361.ENSDNOP00000004115 ENSDNOP00000004115

SEARCH