SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000005792 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000005792
Domain Number 1 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 68-129
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 332-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 458-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 238-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000135
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000005792
Domain Number - Region: 2-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000247
Family SCAN domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000005792   Gene: ENSDNOG00000007479   Transcript: ENSDNOT00000007479
Sequence length 523
Comment pep:novel genescaffold:dasNov2:GeneScaffold_6680:38524:85673:1 gene:ENSDNOG00000007479 transcript:ENSDNOT00000007479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQLLITLPAKASTWVKLHHPKKAKEEVPLWEDVTKMFEGEALLSQDAHVSQRQCLENE
AILGLLTESQELLTFKDISVDFTQEEWGRLAPPHQNLYREVMLENYRNLVSVGYQLSKPS
VISQLEKGEEPWVAEKEDSGDPSSDLKSKTETSESTAKNDISQEKLCHGIMMEKFLRDDI
IYSTLRKVSKYDDELERPQETCRRDVRQAILTHKKRSQETSTFGENIIVGSNVIVKQRRH
KCNTARKRNKYNLDLVNHPASYIRTKSFECSICLKVFKQPIHLTEHMRIHTGEKPFRCKE
CGRAFSQSASLTTHQRIHTGEKPYECEKCGKTFRHRSSLNQHHRTHTGEKPYVCDKCQKA
FSQNISLIQHLRTHSGEKPFTCNARRKTFRQIRHLSEHIRIHTGEKPYACTACCKTFSHR
AYLTHHQRIHTGEKPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDSSFK
KHQRRHTGERPYECNECGKSFSYNSSLSRHYEIHRRKPFQINV
Download sequence
Identical sequences ENSDNOP00000005792 9361.ENSDNOP00000005792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]