SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000006412 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000006412
Domain Number 1 Region: 249-420
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.34e-34
Family Calponin-homology domain, CH-domain 0.00000601
Further Details:      
 
Domain Number 2 Region: 517-627
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-32
Family Calponin-homology domain, CH-domain 0.00000141
Further Details:      
 
Domain Number 3 Region: 5-81
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000223
Family Calmodulin-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000006412   Gene: ENSDNOG00000008273   Transcript: ENSDNOT00000008277
Sequence length 630
Comment pep:novel genescaffold:dasNov2:GeneScaffold_1251:9337:74249:1 gene:ENSDNOG00000008273 transcript:ENSDNOT00000008277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEMATTQFSKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKL
MLDGDRNKDGKISFDEFVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXLAALLRDGETLEELMKLTAEELLLSTRANHLEXXXXXXXXXXXXXXXDSK
AYFHLLNQIAPKGQKEGETRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVS
GNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLY
AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXYTLNVLEDLGEGQKANDDIIVTWVNRTLSEAGKSTF
IQSFKDKAISTSLAVVDLIDAIQPGCINYDLVKISNLTEDDKHSNAKYAVSMARRIGARV
YALPEDLVEVKPKMVMTVFACLMGRGMKRV
Download sequence
Identical sequences ENSDNOP00000006412 9361.ENSDNOP00000006412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]