SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000006899 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000006899
Domain Number 1 Region: 47-118
Classification Level Classification E-value
Superfamily Serpins 0.0000000000000209
Family Serpins 0.0017
Further Details:      
 
Domain Number 2 Region: 258-326
Classification Level Classification E-value
Superfamily Serpins 0.00000000432
Family Serpins 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000006899   Gene: ENSDNOG00000008904   Transcript: ENSDNOT00000008898
Sequence length 326
Comment pep:novel genescaffold:dasNov2:GeneScaffold_5450:64:4950:1 gene:ENSDNOG00000008904 transcript:ENSDNOT00000008898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSPVSATEPLGQQLMGEQTQERLPPLFFLQLGNQLKKDPGACKGAPTPEETRKLAQAVMA
FTTDLFSLVAQRSTSPNLVLSPLSVALALSHLALGARNQTLQRLQQALHADVGPCLLHLL
SRLCRDLGPGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXVAQFPFKNNMSFVVLVPSQFEWNVSQVLANLSWDILHQPLER
ERPTEVRLPKLHLKHQLDLVATLSQL
Download sequence
Identical sequences ENSDNOP00000006899 9361.ENSDNOP00000006899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]