SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007349 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007349
Domain Number 1 Region: 160-247
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.13e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0000847
Further Details:      
 
Domain Number 2 Region: 248-318,541-577
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.15e-32
Family Inhibitor of apoptosis (IAP) repeat 0.00003
Further Details:      
 
Domain Number 3 Region: 21-117
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.7e-26
Family Inhibitor of apoptosis (IAP) repeat 0.00048
Further Details:      
 
Domain Number 4 Region: 440-536
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-22
Family Caspase recruitment domain, CARD 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007349   Gene: ENSDNOG00000009485   Transcript: ENSDNOT00000009481
Sequence length 602
Comment pep:novel genescaffold:dasNov2:GeneScaffold_201:32766:44617:1 gene:ENSDNOG00000009485 transcript:ENSDNOT00000009481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIVEKSTFLSNLMKSACTFELRYDFTCELYRMSTYSTFPTGVPISERSLARGGLDYTGV
NDKVKCFCCGLMLDNWKQGDNAIEKHKKLYPSCSFIQNLSSVSSLGVILQPSPPSPVNST
HSLLPSLENSGYFSGSYSSFPSNPVNSRANQDFSALRQSPYSWAMNTEKARLLTYQMWPL
TFLSPIDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHQRHFPNCPFLENQLQE
TLRYTVSNLSMQTHEARFKTFLNWPSNIPVHPEQLASAGFYYVGHSDDVKCFCCDGGLTC
WESGDDPWVEHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLSTSDTPEDENAESPI
VHFGPGENHSEDAIMMNTPVVKAALEMGFSRRLVKQTVQSKILTTGENYKTVSDLVLDLL
NAEDELREEEKERATEEKESADLSLIRKNRMALFQHLTCVLPVLDSLLIARVINEQEHNV
IKQKTQTSLQARELIDTILVKGNIAATIFKNSLQEIDPMLYNNLFVQKDIKYIPTEDVSD
LPMEEQLRKLQEERTCKVCMDKEVSIVFIPCGHLVVCDCAPSLRKCPICRGTIKGTVRTF
LS
Download sequence
Identical sequences 9361.ENSDNOP00000007349 ENSDNOP00000007349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]