SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007447 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007447
Domain Number 1 Region: 221-469
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.74e-60
Family Protein kinases, catalytic subunit 0.00000000887
Further Details:      
 
Domain Number 2 Region: 120-263
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-39
Family SH2 domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 50-170
Classification Level Classification E-value
Superfamily SH3-domain 8.4e-23
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007447   Gene: ENSDNOG00000009597   Transcript: ENSDNOT00000009612
Sequence length 532
Comment pep:novel genescaffold:dasNov2:GeneScaffold_6313:12551:22298:1 gene:ENSDNOG00000009597 transcript:ENSDNOT00000009612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCGCSSNSEDDWMENIDVCENCHYPISLDGSTLPIGNGSEVRDPLVTYEGSIPPASPLQ
DNLVIALHSYEPSHDGDLGFEKGEQLRILEQTGEWWKAQSLTTGQEGFIPFNFVAKANSL
EPEPWFFQNLSRKDAERQLLAPGNTHGSFLIRDSESTAGSFSLSVRDFDQNQGEVVKHYK
IRNLDNGGFYISPRITFPGLHALVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEVPR
ETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKKLQHQRLVR
LYAVVTQEPIYIITEYMENDNFLDSQLGRGLRISWGNLKQLMLLPTGSLVDFLKTPPGIK
LTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYT
AREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTFDYLRSVLDFFTATEDQYQPQ
Download sequence
Identical sequences 9361.ENSDNOP00000007447 ENSDNOP00000007447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]