SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007801 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007801
Domain Number 1 Region: 215-382
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.97e-49
Family Protein kinases, catalytic subunit 0.00000368
Further Details:      
 
Domain Number 2 Region: 114-257
Classification Level Classification E-value
Superfamily SH2 domain 8.08e-40
Family SH2 domain 0.0000448
Further Details:      
 
Domain Number 3 Region: 32-162
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-25
Family SH3-domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007801   Gene: ENSDNOG00000010080   Transcript: ENSDNOT00000010072
Sequence length 383
Comment pep:novel genescaffold:dasNov2:GeneScaffold_1843:88887:201608:-1 gene:ENSDNOG00000010080 transcript:ENSDNOT00000010072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVCLRLRGYLEPCLPCLLQEADKPVVIENPGARCSPDAPRPRRHGHYFVALYDYQART
AEDLSFRAGDKLQVLDTSHEGWWLARHLEKKGDGSNPQLQGYIPSNYVAEDRSLQAEPWF
FGAIKRADAQKQLLYSENQTGAFLIRESESQKGEFSLSVLDEGVVKHYRIRRLDEGGFFL
TRRKNFSTLNEFVDYYTKTSDGLCVKLGKPCIKVQVPTPFDLSYKTVDQWEIDRSSIQLL
KRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKSLRHPKLIQLYAVCT
LEDPIYIITELMRYGSLQEYLQNDAGLKIHLTQQVDMAAQVASGMAYLESQNYIHRDLAA
RNVLVGEHNIYKVADFGLARVFK
Download sequence
Identical sequences ENSDNOP00000007801 9361.ENSDNOP00000007801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]