SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000008712 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000008712
Domain Number 1 Region: 57-82,125-165
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000006
Family HLH, helix-loop-helix DNA-binding domain 0.0047
Further Details:      
 
Domain Number 2 Region: 165-208
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000418
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000008712   Gene: ENSDNOG00000011225   Transcript: ENSDNOT00000011226
Sequence length 324
Comment pep:novel genescaffold:dasNov2:GeneScaffold_6682:6177:9909:1 gene:ENSDNOG00000011225 transcript:ENSDNOT00000011226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKLKERKVSRLSSDGPCALVVEVALPLIRHLAGPMAGTGPQGTWRLEESRVRTPVSHK
VIEKRRRDRINRCLNELGKTVPMALAKQGEPQAVPKRISRSCWPVISRATVPGLQAPGCC
ESFLPLQSSGKLEKAEILEMTVQYLRALHSADFPRGREKAELLTEFANYFHYGYHECMKN
LVHYLTTVERMETKDTKYARILAFLQSKARLGPEQGLPPRASLPEPDFYPLHPAGPELAG
PGPAEATGFPQSATPGPLPWAHGAARGPALPYLPSAPVPLASPAQPHSPFLAQVQGLDRH
YLTLLSHSHPSALGLHTPQHPPVL
Download sequence
Identical sequences 9361.ENSDNOP00000008712 ENSDNOP00000008712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]