SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000008888 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000008888
Domain Number 1 Region: 2-206
Classification Level Classification E-value
Superfamily Serpins 6.02e-61
Family Serpins 0.00000614
Further Details:      
 
Domain Number 2 Region: 257-391
Classification Level Classification E-value
Superfamily Serpins 9.3e-40
Family Serpins 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000008888   Gene: ENSDNOG00000011473   Transcript: ENSDNOT00000011467
Sequence length 391
Comment pep:novel genescaffold:dasNov2:GeneScaffold_2307:206833:221698:1 gene:ENSDNOG00000011473 transcript:ENSDNOT00000011467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSFSVANRQFGFGLFHELRKTSDGNILFSPAGISAALGMLLLGARGSTAWQLQQVFHPE
KDKDRSRIKAEEKEVTEKSAEIHQQFQKFLTEINKPTNDYELSITNRLFGEKTYLFLQRY
LDYVEKYYHASLEPVDFVNAAEDCRKKINSWFENQTHGKIKDLFPDGSLDSASKLVLVNT
VYFKGQWDMEFKKENTKEEEFWLNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXIVDKITPDKLIEWTNPGRMEEKNVSLHLPRLQVEGSYDLEEVL
AALGLEAAFSSCRADYTGMSARSGLRPQRFLHRSFMVVTEEGTEAAAATGAGMVTASVGD
YENFHCNHPFLFFVRHNLSDSVLFFGRFSSP
Download sequence
Identical sequences ENSDNOP00000008888 9361.ENSDNOP00000008888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]