SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000010091 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000010091
Domain Number 1 Region: 666-875
Classification Level Classification E-value
Superfamily YWTD domain 1.01e-38
Family YWTD domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 1473-1649
Classification Level Classification E-value
Superfamily Fibronectin type III 9.28e-29
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 3 Region: 19-170,335-509
Classification Level Classification E-value
Superfamily Sialidases 1.16e-22
Family Sialidases (neuraminidases) 0.056
Further Details:      
 
Domain Number 4 Region: 1837-2010
Classification Level Classification E-value
Superfamily Fibronectin type III 4.3e-16
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number 5 Region: 1321-1358
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000055
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 6 Region: 1100-1138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 7 Region: 1227-1264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 1057-1098
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 9 Region: 1275-1308
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 10 Region: 1417-1454
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 11 Region: 1025-1058
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 981-1018
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 13 Region: 1179-1215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000010091
Domain Number - Region: 1679-1735
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000136
Family Fibronectin type III 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000010091   Gene: ENSDNOG00000012955   Transcript: ENSDNOT00000013001
Sequence length 2024
Comment pep:novel genescaffold:dasNov2:GeneScaffold_3385:104796:235564:1 gene:ENSDNOG00000012955 transcript:ENSDNOT00000013001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFQKISEKLNFG
PWNSSEAVISQFYHSPADNKRYIFADAYAQYIWITFDFCKTIQGFSIPFRAAELLLHSKA
ADLLLGFDRSHPNKQLWKSDDFGQTWVMIQEHVKSFSWGIDPYDKPNTIYVERHEPSGYS
TVFRSTDFFQSLENQEVILEEVKDFQLRGKYMFATKPLHLLGSHLRSSVQLWGAFGRKPM
QAAQLSAXXXXXXXEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYS
PGGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGAMNEENMRSVITFDKGGTWEFL
QAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNFQLRRMPILSKESAPDLIIATGSVGRN
LASKTNVYISSSAGARWREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYSTNEGETWKM
FTFSEKPVFVYGLLTEPGEKSTVTIFGSNKESXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRKISGDTCSGGDVETRLEGELVPCPL
AEENEFILYATRKSIYRYDLASGATEQLPLTGLRAAVALDFDYERNCLYWSDLALDVIQR
LCLNGSTGQEVIINSGLETVEALTFDPLSQLLYWVDAALKKIEVANPDGDFRLTIVNSSV
LDRPRALVLVPQEGLMFWTDWGDLRPGIYGSNMDGSDTRRLVSEDVKWPNGIAVDAQWIY
WTDAYLDCIERITLSGQRRSVILDNLPHPYAIAVFKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXNACLRNQYRCSNGKCISSIWCDFDKDCGDMSDERNCPTT
ICDLDTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCETHQCRSDEYNCSSGMCIRSSW
VCDGDNDCRDWSDEANCTAVYHTCEASNFQCHNGHCIPQRWACDGDMDCQDGSDEDSVSC
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLCTRFMDFVCKNRQQCLFHSMV
CDGIIQCRDGSDEDATFAGCSQEPEFHKVCDDFSFQCQNGVCISLIWKCDGTDDCGDYSD
EANCENPSEAPQCPRYFQFQCENGHCIPNRWKCDGENDCRDWSDEKDCGDSPLLPSPTPG
PSVCLPNYFRCSNGACVMDSWVCDGYRDCTDGSDEEGCPSPXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTHSTLTCMSTEFKCEDDETCIVLSERCD
GFLDCSDESDERGCSXXXXXXXXXXXXXXXXFSGDVTLTWTRPKKMPSASCVYNVYYRLV
GDSIWKALETHSNKTNTILKVLKPDTTYQVKVQVQCLSRVHNTNEFVTLRTPEGLPDAPQ
NLQLTLHREAEGVIEGHWSPPAHTHGLIREYIVEYSRSGSKMWSSQRSAGNYTEIKNLLV
NALYTVRVAAVTSRGIGNWSDSKSITTTKGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXV
TGYVVNLFWTFDAHKQEKKTLNFRGSILSHKVGNLTAHTYEISAWAKTEVGDSPLAFEHV
MTKGTRPAPSLKAKAINQTAVECTWTGPRNVXXXXXXXXXXXXXXXXXXXXXXXXXXXTV
IVDRDEQYFFLVRVVVPYLGPFSDYVVVKMIPDSRLPPRHLHAVRTGKTSAVIKWESPYD
SPDQDLLYAIAVKDLIRKTDRSYKVKSRNSTVEYTISKLEPGGKYHVIVQLGNMSKDCSI
KLSTVSLSAPDALKIITENDHILLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNT
TDNFFKISNLKMGHNYTFTVQARCLFGTQICGEPAVLLFDELGS
Download sequence
Identical sequences ENSDNOP00000010091 9361.ENSDNOP00000010091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]