SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000010231 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000010231
Domain Number 1 Region: 224-412
Classification Level Classification E-value
Superfamily Serpins 1.83e-64
Family Serpins 0.0000000376
Further Details:      
 
Domain Number 2 Region: 3-136
Classification Level Classification E-value
Superfamily Serpins 6.55e-22
Family Serpins 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000010231   Gene: ENSDNOG00000013198   Transcript: ENSDNOT00000013195
Sequence length 412
Comment pep:novel genescaffold:dasNov2:GeneScaffold_6940:46277:57287:1 gene:ENSDNOG00000013198 transcript:ENSDNOT00000013195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLCVANAIFALNFFKHLVKISPTQNLFFCPWSISSTMAMVYLGARGNTADQMAQVLQF
NKVGALKATSENFTGCNIMQQVQKDAYPEAILQAQAGDLISSSFLALNSAINSSTGDYLL
ESANKLFGEKSAGFKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNERKTVQMMHLHQKLNI
GYIEDLKVQILELPYVGDVSMFLLLPDEVAELSTGLELLEQEITFDKLKKWTSKDTMTED
DVEVLIPQFKLKEKYELKSILKSMGMEDAFSKDQANFSGMSEREDLFLSEVFHQAAVDVN
EEGTEAAAGTGAVMSGRTGHGGPQFVADHPFLFFMMHKITKTILFWGRFSSP
Download sequence
Identical sequences ENSDNOP00000010231 9361.ENSDNOP00000010231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]