SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000010241 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000010241
Domain Number 1 Region: 3-121
Classification Level Classification E-value
Superfamily Serpins 7.07e-25
Family Serpins 0.00017
Further Details:      
 
Domain Number 2 Region: 209-260
Classification Level Classification E-value
Superfamily Serpins 0.0000000157
Family Serpins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000010241   Gene: ENSDNOG00000013212   Transcript: ENSDNOT00000013209
Sequence length 260
Comment pep:novel genescaffold:dasNov2:GeneScaffold_6940:63846:89334:1 gene:ENSDNOG00000013212 transcript:ENSDNOT00000013209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLVTSINQFALEFSKKLAESAEGENMLFSPWSISASLVMVYLGTKGSTAAQMAQVLHL
KQDQDIKSCPESEKKRKMESRVEEIHSDFQTLISEINKPSNAYILKTANRIYEEKTFPFH
NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXTTSKPVQMMSMKEKLLAFHIETPQAKGLQLYY
DSRELSMLILLPEDIDGLQQ
Download sequence
Identical sequences 9361.ENSDNOP00000010241 ENSDNOP00000010241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]