SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000010420 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000010420
Domain Number 1 Region: 271-346
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.79e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 415-461
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000759
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000010420
Domain Number - Region: 202-262
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0061
Further Details:      
 
Domain Number - Region: 80-121
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00033
Family Canonical RBD 0.039
Further Details:      
 
Domain Number - Region: 530-562
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00833
Family Eukaryotic type KH-domain (KH-domain type I) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000010420   Gene: ENSDNOG00000013421   Transcript: ENSDNOT00000013437
Sequence length 567
Comment pep:novel genescaffold:dasNov2:GeneScaffold_607:3211:50898:-1 gene:ENSDNOG00000013421 transcript:ENSDNOT00000013437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNKLYIGNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQXXXXXXX
XXXXXXXXXXXXXXXTMDKLSGHQFARQSVKISYMPDEEVSSPPLRERAQRGDHSCGDQG
HAPGGSFQARQRDFRRRKLVPTQFAAIIGKEGPIKXXXXXXXXXVDIHRKENSGAAEKPV
TIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEH
ETGTKITISSLQDLSIYNPERTITVKGTVEACASAEVEIMKKLREAFGNDMLAVNQQANL
IPGLNLSALGIFSTGLSVLPPPAGPRGAPPAPPYHPFATHSGYFSSLYPPHQFGPFPQHH
SYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNELQNLTSAE
VIVPRDQTPDENEEVIVRIIGHFFASQ
Download sequence
Identical sequences ENSDNOP00000010420 9361.ENSDNOP00000010420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]