SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000011430 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000011430
Domain Number 1 Region: 386-506
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-36
Family Protein kinases, catalytic subunit 0.00000165
Further Details:      
 
Domain Number 2 Region: 185-324
Classification Level Classification E-value
Superfamily SH2 domain 4.55e-36
Family SH2 domain 0.0000085
Further Details:      
 
Domain Number 3 Region: 125-210
Classification Level Classification E-value
Superfamily SH3-domain 6.54e-22
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000011430   Gene: ENSDNOG00000014741   Transcript: ENSDNOT00000014751
Sequence length 506
Comment pep:novel genescaffold:dasNov2:GeneScaffold_4090:4516:140992:1 gene:ENSDNOG00000014741 transcript:ENSDNOT00000014751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPLPPRRASPPLAPPWRLRARRAVASSPRAGRRHLARSARPSPSSPRPAALHAGPPGPSR
RRRSASGSPWSSAARQLATRTGNMGCIKSKRKDHLNDDGVDLKTQPVPDSQLLPGQRFQK
DPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSTKREGFIPSNYVA
KVNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPLHGDV
IKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDA
WEIPRESIKLVKRLGAGQFGEVWMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSLLDFLKSDEGGKVLLPKLIDFSAQIAVGMAYIE
RKNYFHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGC
FTIKSDVWSFGILLYEIVTYGKIPYP
Download sequence
Identical sequences 9361.ENSDNOP00000011430 ENSDNOP00000011430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]