SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000011731 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000011731
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.12e-45
Family TRADD, N-terminal domain 0.000002
Further Details:      
 
Domain Number 2 Region: 166-250
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000565
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000011731   Gene: ENSDNOG00000015138   Transcript: ENSDNOT00000015138
Sequence length 257
Comment pep:novel genescaffold:dasNov2:GeneScaffold_4293:170270:171290:-1 gene:ENSDNOG00000015138 transcript:ENSDNOT00000015138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGGSPDVLQMLKIHRSDRQLIVQLRFCGRQPCSRFLRAYREGALRAELQRCLAAALALSS
LPLQLELRAGAERLDTMLLEEERCLNCIFAQKPDRLRDEELAELEDALRGLTCGPGVQGD
DVEVPLAPSQSLTPSPSEKSPSPSQTFLFQGQPVVNRPLSLQDQQTFARSVGLKWRKVGR
SLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELT
SLAENLLGLADPDNGLA
Download sequence
Identical sequences ENSDNOP00000011731 9361.ENSDNOP00000011731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]