SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013761 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013761
Domain Number 1 Region: 150-292
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-39
Family SH2 domain 0.00000632
Further Details:      
 
Domain Number 2 Region: 83-201
Classification Level Classification E-value
Superfamily SH3-domain 1.17e-26
Family SH3-domain 0.0000683
Further Details:      
 
Domain Number 3 Region: 375-424
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-17
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013761   Gene: ENSDNOG00000017741   Transcript: ENSDNOT00000017741
Sequence length 427
Comment pep:novel genescaffold:dasNov2:GeneScaffold_1580:89722:112566:-1 gene:ENSDNOG00000017741 transcript:ENSDNOT00000017741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKENKSPAIKYRTETPEPVSTSVSHYGAEHTALASSSSAKGTSVNFSNLSITPFG
GSSGVTPFGGASSSFSVVPTSYPTGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINN
TEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFL
VRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFETLQKLVKHYTDH
ADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIED
NEYTARQ
Download sequence
Identical sequences ENSDNOP00000013761 9361.ENSDNOP00000013761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]