SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000014682 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000014682
Domain Number 1 Region: 53-189
Classification Level Classification E-value
Superfamily Serpins 2.36e-49
Family Serpins 0.0000135
Further Details:      
 
Domain Number 2 Region: 3-56
Classification Level Classification E-value
Superfamily Serpins 0.0000000000000576
Family Serpins 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000014682   Gene: ENSDNOG00000018917   Transcript: ENSDNOT00000018916
Sequence length 189
Comment pep:novel scaffold:dasNov2:scaffold_6368:21855:43993:-1 gene:ENSDNOG00000018917 transcript:ENSDNOT00000018916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSLSTASVEFCFDVFKELNSNNGGDNIFFSPLSLLYALSMVFLGARRNSAEQMEKVEKQL
NLKMFQKWTSSSNMVEREVEVHIPRFKLEIKYELNTLLKSLGMTDIFDQIKADLSGISST
KQLYLSKVIHKSYVDVNEEGTEAAAATGESIGVKRLPLRARFMANHPFLFFIRHIHTNTI
LFCGKLASP
Download sequence
Identical sequences ENSDNOP00000014682 9361.ENSDNOP00000014682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]