SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000014763 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000014763
Domain Number 1 Region: 9-240
Classification Level Classification E-value
Superfamily Serpins 3.53e-46
Family Serpins 0.0000658
Further Details:      
 
Domain Number 2 Region: 318-408
Classification Level Classification E-value
Superfamily Serpins 1.31e-21
Family Serpins 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000014763   Gene: ENSDNOG00000019034   Transcript: ENSDNOT00000019033
Sequence length 417
Comment pep:novel genescaffold:dasNov2:GeneScaffold_4186:5938:11886:1 gene:ENSDNOG00000019034 transcript:ENSDNOT00000019033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLPLIGTLCLLAAAALAAEVKKPAADPGTAEKLSPKAATLAERSTGLAFSLYQVVAKD
LALENILLSPVVVASSLGLVSLGGKAATASQAKAVLSAEQLRDEEMHAGLGELLRSLSNS
TARNVTWKLGSRLYGPSSVSFAEDFVRSSRQHYNCEHSKINFRDKRSALQSINEWAAQTT
DGKLPEVTKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMNRTX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVLHATAFEWDT
EGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL
Download sequence
Identical sequences 9361.ENSDNOP00000014763 ENSDNOP00000014763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]