SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000016002 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000016002
Domain Number 1 Region: 48-309
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-37
Family YWTD domain 0.0000202
Further Details:      
 
Domain Number 2 Region: 2848-3037
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-36
Family YWTD domain 0.0000176
Further Details:      
 
Domain Number 3 Region: 423-614
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-29
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 4 Region: 1151-1254
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-17
Family YWTD domain 0.00035
Further Details:      
 
Domain Number 5 Region: 757-793
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000746
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 6 Region: 3275-3313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 7 Region: 914-955
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 2551-2587
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000119
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 9 Region: 2792-2839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000138
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 10 Region: 2674-2715
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 11 Region: 2634-2674
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 2383-2424
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 13 Region: 798-834
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 14 Region: 3233-3276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 15 Region: 674-711
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 3195-3236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 17 Region: 2717-2756
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 18 Region: 2347-2385
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 19 Region: 2591-2633
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 20 Region: 835-873
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000123
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 21 Region: 717-753
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 22 Region: 2758-2806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000339
Family EGF-type module 0.012
Further Details:      
 
Domain Number 23 Region: 879-914
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 960-996
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000106
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 25 Region: 3-37,613-668
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000188
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 26 Region: 2429-2467
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 27 Region: 2517-2545
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000615
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 28 Region: 3171-3191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000055
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000016002
Domain Number - Region: 1003-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000876
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 1350-1390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00998
Family EGF-type module 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000016002   Gene: ENSDNOG00000025117   Transcript: ENSDNOT00000024095
Sequence length 3318
Comment pep:novel genescaffold:dasNov2:GeneScaffold_7426:91:55491:-1 gene:ENSDNOG00000025117 transcript:ENSDNOT00000024095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FDDCQIWGICDQMCEDHDGHHQCHCAEGYVLEHLRHCRANSSSGEPSVIFSNGRDLLVGD
IHGRSFQILVHSENRGMAVGVDFHYQLQRVFWTDITREKVFSVDINGLNFKEVLNVTVDV
VENLAVDWISNKLYIVETKASRIDVVNLNGSHRVSLITGNLGHPRGIALDPTVGXXXXXX
XXXXXXXPRLERAFMDGSNRNNLVKTKLGWPAGITLDMLSKRLYWVDNRFHYIETVTYDG
LQRKTVVSGSSVIPHPYGISLFEEHMFFTDWTKMAVMKANKFNDTNPQVYYQSPAKPFGV
TVYHSFKQPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMIAKQ
RTDGTGREILVADMAESVESLSFDWISKNLYWTDAIHKISVLRLADKLICTIAQSLNNPQ
SIVVHPIMGYIFYVELYHPSRIVRAWSDGSHALPIVNTALESPNGLAIDWDGLRLYWVDV
LLDKIEHSTFDGSDRRTLSNIQEMKHPFGLTIFGDYAFFTDWTLSVIVRVRKTDGRERTV
IRRGISNLLLVKSYDENIQTGSNYCSRPTNPNGDCSHFCFPVPNLQRVCGCPYGMQLSAN
HLTCVGNSSNHTAAQHCGSFSFTCNNGRCVPRENRCDGLDDCGDNSDELLCGSSNNTCSP
TAFTCGHGQCIPASLRCDGHDCVDGSDEQDCSPRLAASCPPDRFTCDNKLCIPTRWVCDG
DNDCGDGSDERNCSVEDTCPFGQFKCPERRCIDLSFVCNGEKDCADGADEVGCVYNCTAL
EFRCASGDHCVSNTYRCDGVYDCQDHSDEIGCPTRPSGICNHDEFPCQEDGSCIPHTWEC
DGHPDCIHGSDEHKGCPASTCPESHFRCDNGNCIRKTWVCDGDNDCTDRSDERDCHPQPF
HCPNWQWACPGHSICVNLSKVCNGIPDCPDGADESPICNLQSCLRYNGGCTHSCFQGPFG
AECRCPLGYVLANDSKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVLDSGFSMVETIAIDWVGRNLYWTDYAVGTIEVSKLDGSHPTVLISEN
ITNPGELALGPRINYHLMFWSSWGHHPVIERASMDGSMRTVIVQDKIYWPSGLADYXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNSCVSAPCSHLCLLSSQGPKFYSCACPSGW
ILANDAVNCLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNGAECQCPSEGHWYMANSNKH
CIVDTGRRCEGTQFTCLNGHCISEQWKCDITNDCDDGSDELESVCAFHTCPATAFTCDNR
RCVRNDFRCDHYNDCGDNSDEIGCQFRSCNSTTEFSCNNGRCISLQHVCNGVNDCRDNGT
SDEKNCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXC
ISGHCIPAQWYCDGGKDCADGSDEPASCGHERTCLSHQFTCDDGRCIPSYWVCDGDNDCG
DMSDEDDRHHCENRTCSSSEFTCHSTPSSRKCIPRNWVCDGDVDCADGSDENQNCTGRSC
SGDEFTCNNGLCIHHSYRCDRHNDCGDYSDERDCSYPTCQESQFTCQNGRCIPKAYMCDG
GNDCGDDSDELEHLCSTPEPTCPPHQFRCNNGHCIEMEKICNHIDDCGDDTDERACGINE
CNDPKISNCDHNCTDTPTSFYCSCNPGYKLMSDKRSCDDIDECMETPSVCSQKCENTVGS
YICKCAAGYIREPDGKRCRQDSDITPSLIFSNRYYLRNLSIDGQFYSLILQGLGKVVALD
FDRVENRLYWLDTERKVIERMFLNGTNRETVIRSNLPNVEGLAVDWVTRKLYWLDVSLNC
LSVSDLDGRFRRKLAEHCVDANNTFCFEYPRGIVLHPQYGHIYWTDWAYRAYIGRVGMDG
TNKSVIISTKLEWPNGITIDYTTDRLYWVDAHLGYIXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCIPIWWKCD
GQKDCADGSDEPAFCPQRHCQLGQFQCTDGNCTSSHFLCNAYQDCPDGSDEDDILCETHH
CESYQWQCANKRCIPQHWQCDTENDCGDNSDEETSHCANRTCLPGQFRCANGYCIPEHWK
CDYENDCGDHSDEPFEEC
Download sequence
Identical sequences ENSDNOP00000016002 9361.ENSDNOP00000016002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]