SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000016147 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000016147
Domain Number 1 Region: 1245-1510
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-51
Family YWTD domain 0.00000241
Further Details:      
 
Domain Number 2 Region: 513-746
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-39
Family YWTD domain 0.0000109
Further Details:      
 
Domain Number 3 Region: 3848-4058
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-32
Family YWTD domain 0.0000289
Further Details:      
 
Domain Number 4 Region: 3003-3153
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-32
Family YWTD domain 0.0000471
Further Details:      
 
Domain Number 5 Region: 1158-1237,1503-1555
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000439
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 6 Region: 825-867
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000615
Family LDL receptor-like module 0.0000883
Further Details:      
 
Domain Number 7 Region: 3627-3672
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000128
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 8 Region: 906-945
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 9 Region: 3540-3583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000164
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 10 Region: 3586-3622
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 11 Region: 866-908
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 12 Region: 3-43
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 13 Region: 1038-1083
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00015
Further Details:      
 
Domain Number 14 Region: 3344-3382
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 2576-2613
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000102
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 16 Region: 119-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000174
Family EGF-type module 0.004
Further Details:      
 
Domain Number 17 Region: 3385-3422
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 18 Region: 47-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000877
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 19 Region: 2937-2989
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000298
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 20 Region: 1119-1154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 21 Region: 1082-1116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000746
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 22 Region: 2633-2663
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000124
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 23 Region: 779-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000014
Family EGF-type module 0.041
Further Details:      
 
Domain Number 24 Region: 951-984
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000838
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 25 Region: 3668-3706
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000314
Family LDL receptor-like module 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000016147
Domain Number - Region: 463-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000798
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1560-1630
Classification Level Classification E-value
Superfamily YWTD domain 0.000889
Family YWTD domain 0.0031
Further Details:      
 
Domain Number - Region: 93-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000016147   Gene: ENSDNOG00000025390   Transcript: ENSDNOT00000023962
Sequence length 4518
Comment pep:novel genescaffold:dasNov2:GeneScaffold_2520:18645:88284:1 gene:ENSDNOG00000025390 transcript:ENSDNOT00000023962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKTCNPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKVQRCQPNEHNCLGTE
LCIPMSRLCNGIQDCVDGSDEGPHCRELRGNCSRLGCQHHCVPSLSGPTCYCNHSFQLQA
DGKSCKDFDECSVYGTCSQLCTNTDGSFTCGCVEGYLLQPDNRSCKAKNEPVDRPPVLLI
ANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPG
LKGFVDEHTINISLSLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSHACENDQYGKPGGCSDICLLANSHKART
CRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRGMDVGAKVPDEHMIPIENLMNPRA
LDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDAIHNVEGVAVDWMGDNLYWTDDGP
KKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNGWMYWTDWEEDPKDSRRGRLERAW
MDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFYDRIETILLNGTDRKIVYEGPELN
HAFGLCHHGNYLFWTEYRSGSVYRLERGAAGAAPTVTLLRSERPPIFEIRMYDAQQQQVG
TNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGVTCLANPSYVPPPQCQPGEFACAN
SRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFKCENNRCIPNRWLCDGDNDCGNS
EDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFT
CNNGRCININWRCDNDIDCGYYLDVVCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXTRPPGGCHNDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKSCEGVTHVC
DPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENCESLACRPPSHPCANNTSVCLPPDK
LCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAPGEGIVCSCPLGMELGPDNHTCQIQ
SYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGESCRSLDPFKPFIIFSNRHEIRRIDL
HKGDYSVLVLGLRNTIALDFHLSQSALYWTDVVEDKIYRGKLLDNGALTSFEVVIQYGLA
TPESLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTLLAGDIEHPRAIALDPRDGILFWT
DWDASLPRIEAASMSGAGRRTIHRETGSGGWPNGLTVDYLEKRILWIDARSDAIYSARYD
GSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTNTQPFD
LQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNRTVSCACPHLMKLHKDNTTCYEFKKF
LLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLDYDAREQRVYWSDVRTQAIKRAFI
NGTGVETVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGSVEGLAYHRGWDTLYWTSYTTST
ITRHTVDQTRPGAFERETVITMSGDDHPRAFVLDECQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTACG
VGEFRCRDGTCIGNSSRCNQFVDCDDASDEMNCSATDCSSYFRLGVKGVLFQPCERTSLC
YAPSWVCDGANDCGDYSDERDCPGVKRHGCPLNYFACPSGXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCR
CRPGFRLKDDGRTCADVDECSTSFPCSQRCVNTHGSYKCLCVEGYAPRGGDPHSCKAVTD
EEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVALDFDYREQMIYWTDVTTQGSMIRRM
HLNGSHVQVLHRTGLSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLSGAYRTVLVSSGLRE
PRALVVDVQNGYLYWTDWGDHSLIGRIGMDGXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRARPEFKCRPEQFQCSTSIC
TNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDER
DCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCGDNSD
EESCTPRPCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCTPRCDMDQFQCKSGHCI
PLRWRCDADADCMDGSDEEACSTGVRTCPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDEN
PEECAQFVCPPNRPFRCKNDRVCLWIGRQCDGTDNCGDGTDEEDCXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSE
YQVLYIADDNEIRSLFPGHPHSAYEQAFQGDESVRIDAMDVHVKAGRVYWTNWHTGTISY
RSLPPAAPPTTSNRHRRQLDRGVTHLNISGLKMPRGIAIDWVAGNVYWTDSGRDVIEVAQ
MKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDETFRDTLVQDNIQW
PTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPIVAADSKRXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVFWYKRRVRGAKGFQHQRMTNGAMNV
EIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPTNFTNPVYATLYMGGHGSRHSLASTDE
KRELLGRGPEDEIGDPLA
Download sequence
Identical sequences 9361.ENSDNOP00000016147 ENSDNOP00000016147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]