SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|100919|fgenesh1_pg.C_scaffold_16000164 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|100919|fgenesh1_pg.C_scaffold_16000164
Domain Number 1 Region: 400-525
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-26
Family C-type lectin domain 0.00081
Further Details:      
 
Domain Number 2 Region: 46-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000013
Family MAM domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|100919|fgenesh1_pg.C_scaffold_16000164
Sequence length 528
Sequence
MQSCLSSFLVGLFLLLLIDKPSTLIASCQHQMCHHTVGPTTLVELVNLDSDFENGQIDPW
IEQSESGVKWRVENTTSPWEPGNVAPTPTNGSTYLRVDRGSTLSFGVAILRSQTFTLGSD
TQVSFSFSFWIRSKWPQFTNLELYLAKNGNEGLLLNLYEYSHINNRVWQSQTVSITDDSS
SNLTLVLYAYCGTKAEDAVAIDDLRFISSQQSASTTSTTLTKTSLWTTATPVTSSTTSTG
TTLSTTSTTSTTPTTSTTSTTSTTFTTFTTSTTPTTSTSSNDFEMTENSTGPITSTISSE
LPETSTPGTETVETSPPTITTTSATPLPTTSDQTTTVTTEETTTEEQSTVITSAGSTEFT
DITDAITTTTEPATTIPEGEDCPSYLEGNTKMPCWTLGGKCYCFFTDAVGKNWISADTFC
KDEGMGLLSLETVEEDKLIYDHIKITPELNSVSYWTSGMYSLDGDKIWEWASTEPFQPLT
YVNWSPGQPDNNGPGYCLHLDLIKTFSAGYWADIFCTNSFRFICESIN
Download sequence
Identical sequences E9GBN9
jgi|Dappu1|100919|fgenesh1_pg.C_scaffold_16000164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]