SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|101679|fgenesh1_pg.C_scaffold_18000243 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|101679|fgenesh1_pg.C_scaffold_18000243
Domain Number 1 Region: 50-112
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000392
Family Pan module (APPLE domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|101679|fgenesh1_pg.C_scaffold_18000243
Sequence length 157
Sequence
MSKVYWLFFLLVAGDVRAEVNPEELLEVKTTSDDLAKSEERCGIVNPSTTNRNIPSVTYS
TNCDFCDHALYTVTCIPNAFACAALCAGDRLCSHFTYVGNLNRGTCRLKSAIGSGGSWAS
SVKAPSPYICGYIPSRALVDVFLNICVGTDITGVVRR
Download sequence
Identical sequences E9GE63
jgi|Dappu1|101679|fgenesh1_pg.C_scaffold_18000243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]