SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|104167|fgenesh1_pg.C_scaffold_29000046 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|104167|fgenesh1_pg.C_scaffold_29000046
Domain Number 1 Region: 157-273
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-19
Family C-type lectin domain 0.0019
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|104167|fgenesh1_pg.C_scaffold_29000046
Domain Number - Region: 32-128
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000301
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|104167|fgenesh1_pg.C_scaffold_29000046
Sequence length 275
Sequence
MTLFLSFCILTLSSLLSSIHCSGLVPSGLEACGGSLYVEDAVVIDVPHQENCIWKVQTDK
DHILVFSLADGGNFERIHDFTTIHDGLDGDAPALLLENQIHHEVGLTRAGILNSVYTTSS
EAAVRFKNAPTSTFKLRIQKAVNCPFNVGSESQCGRILDDISCYCGIFTKRSQSSQSAFC
INNQMKLLAIESLVEEQAIYFNWPTTYFWTSGSDIATEGIWFWESTGVKLYPGYANWGNS
EPNTVDSEDCIRIYSTVGWMDYTCGTSLDAICEAT
Download sequence
Identical sequences E9GLF5
jgi|Dappu1|104167|fgenesh1_pg.C_scaffold_29000046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]