SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|104316|fgenesh1_pg.C_scaffold_29000195 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|104316|fgenesh1_pg.C_scaffold_29000195
Domain Number 1 Region: 29-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 114-198
Classification Level Classification E-value
Superfamily L domain-like 0.00000167
Family Ngr ectodomain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|104316|fgenesh1_pg.C_scaffold_29000195
Sequence length 349
Sequence
MRCTLLGGLCAFCLLLTISIVIILLSQSSSCPLGTFRCLGNDSEIGVCLPRRLLCDNRPD
CPDGSDEDPLKCSDNYGELQSFVNVVSENPGPESTTVPATVSPFFANCSAKAYPRGCTCQ
NRTWLFCLNLDLMLVPQVEARLSRLVLMNNSIRRLSVQDLEGYDLEFIRLEDNLLEVIED
DALSHQRNLTKLVVYGKNVVATFFLLVFVSDNKESNNKEKETNAGWQQTIGPLCEHLSRT
GSFEVALFVSQPVGQHDEHESLSSSDIVTLAGLVSQRLGSRIGQCLPTFGLALGSLSERK
SNSDDTEQYGGLFNQPDSIGSEAQFQFNFIQTQFQFEKFTRMPSSFYPD
Download sequence
Identical sequences E9GLW6
jgi|Dappu1|104316|fgenesh1_pg.C_scaffold_29000195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]