SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|104541|fgenesh1_pg.C_scaffold_31000004 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|104541|fgenesh1_pg.C_scaffold_31000004
Domain Number 1 Region: 166-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000207
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 121-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 88-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000803
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 221-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000572
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|104541|fgenesh1_pg.C_scaffold_31000004
Sequence length 259
Sequence
VIIGRIVAGLRLDESTKETVSEKGIHDLHRVQSDSKVLVATGAITTAVFFIQPNSVADVL
RELHGSLSIRSCRGTRSEKKIQFCTKDLNPCKNGATCVDRGDHYACQCALGFSGENCTVN
NDDCISHMCQNGGTCVDGINECTCKCPPAFSGKFCEAYPMVSLLYPQTSPCQQHDCQNGI
CFQPQGLTDYICKCPSGYTGKRCEFLTSNYESMMNTLKTSVLTSYDPCKDHRCRKGQCVS
KKNGKNYSCKCQARWGGKY
Download sequence
Identical sequences E9GMK5
jgi|Dappu1|104541|fgenesh1_pg.C_scaffold_31000004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]