SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|106738|fgenesh1_pg.C_scaffold_44000111 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|106738|fgenesh1_pg.C_scaffold_44000111
Domain Number 1 Region: 162-243
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000000000000745
Family Hairpin loop containing domain 0.032
Further Details:      
 
Domain Number 2 Region: 255-335
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000000000133
Family Hairpin loop containing domain 0.041
Further Details:      
 
Domain Number 3 Region: 363-451
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000000228
Family Hairpin loop containing domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|106738|fgenesh1_pg.C_scaffold_44000111
Sequence length 1151
Sequence
MIDSREIVNVSNNRGEYRLKSQTSCNFGLGRIVYEKLPHQQLQGYDDDVVRDASPPMQVL
TRCQDLCLRDRTAANNLVRTCSSFDFQPGKRLTLPNSLAAPFNSPSTSPSVSGAVEYDES
ICFLSRELPRPEGLGALVNLPGHFLYSEVCLSSARIERECPNRKSVFDRITRKRFRPSGS
KEYFVNNRTECEDKCLNEYSFVCRSISYDSTSRTCSLSRYTRRTHPEQYEDDPGFEYLEN
TCLSEDRRCEGQLTFVREERGQMLTAFDSEIMINTTIEECQARCLSADTYFCRSLTYDPI
SKACVLSSEDSASLSDQEVATMTGTGYYYFEILCMALGANEVNPLSQRGEGEASPLLVDG
RRRDILTAFQRYRNSRLSADFQTEITDRSLAECLDECLRQQKLTVTLFVKQTSYRCRSTM
YSERFRVCRLSRSDQKDGRLIYEPDYDYYESLSGGVIGGGGLGPSSIDDYNPSLVTPYRP
PFIMPGGSQQVMNETVFESSSSFVNRPEEFGEITGSSAVGGFAASSAVPAGSWPPGIVPE
IQSDDPYYAGPWPAGSGISPGGLPGGSSTGLGILPGGNQLGNRPRCEPGREHDGFRQVRR
LPFFSNAIGGERENCELSDRSTRELDTSNPSFFETNGDYDFYERSQTSDCLDVSQVCNED
GMEFTLRTPEPFTGRIYTYGFYDRCFFRGTGGLTNVLRITGPRGFPDCGSQRHGDILTNI
IVVQFSEMVQTARDKRYNLTCLYGGPGEAVVTSGYIGAGSGSPTPIEFLPAQNILDSRVR
LLIMYQGRPTTTIAVGDPLTFKLESLQGYNLIADIFATNVIAKDPYTGKSVQLIDRFGCP
VDDGIFPSLDRARSGEGLEAAFNAFKIPESNFLVFEATVKSCRGGCQPVFCNTNNVPGRG
SGQSYGRKRRDSPAGFALNKPAWLSLSSSSSSSTMKPIEDTNEEELVMEMLRVYANRDEI
PENTVSLQKLDICLSRVEYYSLITSLGIILLILIASSFVAGLCFRRYRLLHFKNAGADAT
APHSMLSHNTYGQQRQRNLFHHTPSARNFAFINRAFDLRTPPESTDGDRQTELDFGEGEV
ADRAVSRKGQHKQQSRAFQDPSEPIYTEPSLFERSRSLRSVAAPDLRRVVHRTTAEQPAI
KEVPDTESAAL
Download sequence
Identical sequences E9GUF9
jgi|Dappu1|106738|fgenesh1_pg.C_scaffold_44000111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]