SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|107461|fgenesh1_pg.C_scaffold_50000025 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|107461|fgenesh1_pg.C_scaffold_50000025
Domain Number 1 Region: 158-330
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.86e-41
Family MAM domain 0.0019
Further Details:      
 
Domain Number 2 Region: 39-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000222
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 89-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000528
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|107461|fgenesh1_pg.C_scaffold_50000025
Sequence length 433
Sequence
MAARRNWKCPTLLLITVVFWLNAANCQQQTASNISRKKLTCPVASPPKNGKIKLGLGGRE
AKYSCNQYYVLVGQNTSTCLQGEWTSETPVCAIDGCLFDPSPPSGRFIPSGGGAVLKLEC
DPGYRPSGWPLIYCVDRFVWNGTAPHCQANGDVQQSATRCDFESQDLCGWVQDTRADEFD
WAWRNDNGTSSFHLGTGPSFDHTLGEGKAGHYLFIQFSNRVLNGTARLFSPVYGPPKASA
AVNEEVCFSFWFHMYGSTTGQLQVYIKPESKKMSELKPVFIHSGDQGDHWRQGYISLDTV
TENFQVVIEGVRGSGDAGDSAIDDVQLTKGEECLAALKRMMPDTETTTTQPSSTIPPPSN
PTTASTTSVLLNGDPPQGGLPADEQPVITANQQSSSSGASIQVSLPNWLIVVTVVVAALG
DSLARDGWCRRRP
Download sequence
Identical sequences E9GX58
jgi|Dappu1|107461|fgenesh1_pg.C_scaffold_50000025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]