SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|10825|gw1.128.6.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|10825|gw1.128.6.1
Domain Number 1 Region: 269-575
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.83e-76
Family Protein kinases, catalytic subunit 0.000000237
Further Details:      
 
Domain Number 2 Region: 137-207
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-20
Family Kringle modules 0.0019
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|10825|gw1.128.6.1
Domain Number - Region: 4-91
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00131
Family Frizzled cysteine-rich domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|10825|gw1.128.6.1
Sequence length 593
Sequence
EGFCQVYRGATCSKFLANRTIFVQSSLTQGIVEEKLAAAFTVIAHSGDLSQSCAEFAVPS
LCFAAFPLCDDQGGKPVPRQLCRDECEVLENDICRMEYAVAKQHPLIGEQVMLPDCEKLP
PIGSKGSETCFRIGIPHMAQIVEEQSCYNEDGRDYRGIASRTTSKQDCLPWNRQAAVKSA
DHSELIGGHNYCRNPGGVEVQPWCFVAGVEGPNSRPRREFSMGYDINWLYIIIPAAAVGL
LVIVILVVCCVRRSKCKAKNSSVMIKGPNSMVSTLQGQSTPSRIHVPEISLHAVRFQHDL
GEGAFGKVRKIKLIYPGQIYLNPGGVMPIAIKTLKANASVKTQQDFRREVELMSELRHPN
IVCLLGVVTRDQPQCMLFENMAQGDLHEFLVAHSPAGDGSVSGIGAGSDDGTASTLEQSD
FLYIAIQIAAGMEYLASHHYVHRDLAARNCLISDNLIVKISDFGLSRDIYSSDYYRVQGK
SMLPVRWMPPEAILYGKFTIESDVWSFGVVLWEIYSFALQPYYGYNNQDVIDMVRSRQLL
SCPSECPSRIYSLMIECWSEVPLRRPTFTEVHNRLRSWEGLASVGAPSSSIGG
Download sequence
Identical sequences E9HHV1
jgi|Dappu1|10825|gw1.128.6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]