SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|110476|fgenesh1_pg.C_scaffold_75000041 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|110476|fgenesh1_pg.C_scaffold_75000041
Domain Number 1 Region: 4-104
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000017
Family Spermadhesin, CUB domain 0.0091
Further Details:      
 
Domain Number 2 Region: 652-693
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000524
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 3 Region: 155-223
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000157
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|110476|fgenesh1_pg.C_scaffold_75000041
Domain Number - Region: 356-478
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00785
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|110476|fgenesh1_pg.C_scaffold_75000041
Sequence length 765
Sequence
MSYRNVTCYYYIRQAWSPKNQTILLTLVQTEPGQSFSVRTSDAGDKERKMMSGRECRTRV
DDTVSIYNGATIESPLLARLCGTGNMPHITGAGGELLVVFRSQPHDAPFNPAPLGASPGF
RLTTRVRFVAANQVRQYHPECRISITSSGSNSRRSQRQGIIRSPEATMAPNTSCLYEFTG
REDQRVWMTFLSYRLDGGEDGDCLTLTDGQELVSRQCGAAVQPRICPHALVHANSSTAYK
PCRWQDGESYLSRSPRFTIRQELATGTAIRPWSFVIRFEFITVDRFSPKEQLVSSSSGGG
QQEQHESAAPNGSSGMTTGVADSPEAPSSTGDEDDQQLAWQMMTPDCFQLLESAKGNGSV
SSPRNPLLYGRGGSRHLRCLYRFQAGKGEHTHLTINPFHSTGCARFNQSGCQACLSVDEV
FWGGQVRRRSYHTCRSLSGNNPVVLQSAASSLELIFEVRDMNWAQDDDHFYFVAEYSFSG
GIDPACWDSHQQTGKRGSLRIDPRDRCVRHSIPWHIQAPRGGYIILVFPAGQASVTKTVE
GCPTNNRLFVYSITDGKTQLYREVCLMAGGLQQQQTGGDIKAQQQQQPLNLYSAGWSERN
WMADGLLVVASLQGVPIADETPLVVTWLSVFKDVSSKSMSFAARQSVYGANASSSQMVCR
TGCPALGACLSSDLWCDDRDDCPDGSDERQCIRLVFWPLYVGLVVILLSLTAGLVTVYLV
HRYYQARRYTANGRTYKPRPKETKAKFSSVTVSLTRHYEKGGPGS
Download sequence
Identical sequences E9H6D3
jgi|Dappu1|110476|fgenesh1_pg.C_scaffold_75000041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]