SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|110857|fgenesh1_pg.C_scaffold_78000077 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|110857|fgenesh1_pg.C_scaffold_78000077
Domain Number 1 Region: 25-73
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000197
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|110857|fgenesh1_pg.C_scaffold_78000077
Sequence length 154
Sequence
MSAPLRSGECWFFTLLGFRSLMKECHRVNCGFPGYILNELANITNFSNTVSYNCIKGIRL
SSDGTCPCEENSHLSAFWSLASQRFSQSSAPRLGRRCLQNSMLSATGFPSSVQAGRTVFF
DLPGREEMGRHPPSFPTSEMHARPVWNSSGDLQR
Download sequence
Identical sequences E9H7D2
jgi|Dappu1|110857|fgenesh1_pg.C_scaffold_78000077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]