SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|119280|fgenesh1_pg.C_scaffold_667000001 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|119280|fgenesh1_pg.C_scaffold_667000001
Domain Number - Region: 1023-1064
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0111
Family C-type lectin domain 0.041
Further Details:      
 
Domain Number - Region: 1322-1371
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0589
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|119280|fgenesh1_pg.C_scaffold_667000001
Sequence length 1809
Sequence
MSLSETTVSPQGNIEGETKECLPEISQSELVHPQSDKILRRKKGLKEKIGFRARNGAVYQ
LPLTEKESVDERNQKTSNADNLSKEMPNYFEILRKTVKAEIKESKERKPSKIPVTNPRWN
KKHQREIEQDKRSLQSWFEHGIDSRAYAPKSSNNNSESEQDNSERYVNRLRVKKQPTLGD
YVPSFKLRTENSGSQPAVNDSQPAVNDAQPANESMSYELEDESTSPWELALTAQQCERLR
NVLRDTRYQSQMVCKEFYSRVGEPYPGCCGPLNDPNIDSECGEKESLTSVLKDLKRYIEY
FTSFSGFDNEEYTHLTYTQGKMPLCIHGIRYQIKRCCEAIISEGIALLDLLPEDQVTFFS
QEFRRLISSIDNTQKCHMTKKLVPCMHKFCRWEEIDIPVTNVRERMLYHSSTPKNDMIAF
EVKRAQVSSIYRRIDITLGTEVIEKEKYVSPYKYSRAMKEFDISKSELMSNRLNQLMNVV
YRETFLLMESLPRQEVKVLRENIDMFNFATYEMRDKELRKKILRVQSESPYFGESESRWT
NYQSSTASEEEYDVPVMPDSLPEQRRPAFATKAEKQDHPSETVRLERMDFEYLTKLSNSP
LGHFETPKQLSPAIRVECCSPSWLYHVRGKDGTHMVFDDHGEAVNYSVALGIDEQRETDP
KQVSQSHPPMFNSVTVEKLRNNKVIEYNSGASLKKLRNVLNSLQSICVDTFIYDVNKEIL
VDVINERHSMVIRMIQENIEAIRIMCCLDRGHRRKLITRAEQNRRNKSLLKYVSIQPRKV
SKVANGENNSTNEIVGEIDTYYPILPDKSNISDKSNIPDERNISDRFDRGMNELNQIIGT
TNSHKLNNYYPEPDNVISGNEKESVTLNRNVFPGELNIKDIMLEGRNPFSQVIVSTTNKY
MGTERIVPYFNMMLAKLFGKDEKLDKLIIKNQIAYHFKKVVREVSQELFVSRRIDVSLLF
AGIQVLRKTESEVRKVCDELPRKRVFDTKPAPETKHTIETKIIHLDSNGKNLQSEQFLVV
KSPHYASFKEAKARCLALGMQLPEIYSANQMTALSEFLKENGIYQCFAGIEPDLSDAIQR
HIMTQYPIWKTAYKSLHECTRAGDKLVATDLVYSLDDGNAKFLYTNDNRLCVTRDTVDNP
FFTNKYGAMEFRERHHTLSQIISRIVCSRKWDGLTDVDLPDDQMKRGGVKTDSRVYRKRR
EIQINKLRLRRQASNVNSDMANVQSFCYGVADQAKESYEDIQSKLNDLLALVDITVHPEI
IDSSRRQKRVIPLFLAKFIFVTGVKVLWQLFGFVQKVKMNKRLKNIESMLKATENRSLQN
SEAISNMTKLIYGNSVAISQLNVRVDGLESRLNLVEGQIGVLQQDFSGLSYKFETVASLN
TIDNLIVRIRKSMDSGYDILKDIIHCSKLKQTSPLVLPLDQIELVQNEISKVSTALLDPD
FSKMQSIVVSDPNDPSMLLVVVNVAALSRRNLELVKMLPVPYFEGKEAYEIMLDYHTVVL
DQTTHTFSILTEQEEYSCLFNRCYVGSSEQSLLERSCGIPQYYDRHKEACVSQSTISTGV
FLKPMLPDGVIFALQNEVQSQIFCKDEQIGKTRKLKGTGVLQLPNGCTLSVIDKAGRVSK
VKGQPLYTMVSAGDIELMPNGPLSALYTDVDMNGTRKAASVNAFVEERVSSVLRQVETVD
GKMSEQHKHVWALTAVISLSFTVIILVLYLMYRYSTRARRKMNDIRDNFKELTHKILDHE
SGNPVPVGLNDDAETPSAPMPVQRRRDVWLRHLREQRAIALKSLKRPITRQSTGNSGSSV
PKKRRYVRK
Download sequence
Identical sequences E9HY21
jgi|Dappu1|119280|fgenesh1_pg.C_scaffold_667000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]