SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|119545|fgenesh1_pg.C_scaffold_799000001 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|119545|fgenesh1_pg.C_scaffold_799000001
Domain Number - Region: 143-215
Classification Level Classification E-value
Superfamily C-type lectin-like 0.031
Family C-type lectin domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|119545|fgenesh1_pg.C_scaffold_799000001
Sequence length 1852
Sequence
MQHLKKFSSHPKFDKGRRKQIFAKILKMSTEGKESVLKLLLILGLLIFPQTVSISPSTLR
GGLVYQEKTTQGPVYVNVETITLIRKADTTDLLNSARTSRSMINTYQNFCRKVANRVTIF
DKPRKPTRAEVAEPPYVHPFDIHFSPFKYPILDAPQVCKEMGGRRPEIRDKQSMEAIRFA
AITKGVVKISAGIQYDSNNNVFRYISDDVNARYQSPFSFLEYGGYYIGQAYRASNWEDEY
AVQSYADKYPIIYNHPEKEFVIRLGDANDKGFKDYIMCEVPKSETGERLKEENNLILQVT
DHACKRDAQGLVASTNIIINEIEAITNLNVTLPEEIQTMDHFFPQVVANYDFDEDKKKRK
KRSAGRKLPRFNRLRPAFISAILPKEKTPERELKRMEEDIGHDEAGPVLLSMYHSYRTMQ
KAKYPSTPLTFDKYLMRNAMEEYFKVVNDSYFGDIYSYKIEYHDDMPPIMNYEETAIKRV
YTKTMDKEKLKTMVRLFKKYSWFKDLVFDSTKSDIIPYLQLSKINGMTRWEIFAKITQKV
RNDVTYKRRNKRETHVNSHLAQLYNIHTIRSLAKYKDPSFQDWLRSKAVVNFYSTKEHFA
FYSTRFGKILYDTRNFPIVTTPMGDIQEAAKRMTTPSTIKSSSQTIQRRHLKEAQKMTSQ
AALKAQAKLYKEEPWYREETDRKTDMFVRIYLIEDLYNGEPRGALFTKYTNSIKKEEINA
SRPRATRPTTTTTTTTSTTTTSTTTTPTTTQKSQKRTRRTPIGPLALLGVGLGSAAAVNA
ISSSITGDAPLSWGGKTMGSLFGLKTAGRSDFQANERLGQALEDLKVNNNELVSSVNLVT
KQMTTVTSALNGHFKSTATMVMEQDIKMYIRHILLVQEDAIQKYAHIMLAASLHQVSPYA
LSQKELDKTADELKMKKGIILVRDLTSSRCEATIVDGELFLQIEIPIINEANLFNFYQIK
PVPIFIENATMMPVIDSTVIAISKTGSDYAIVTPEELATCTNTPWKCQLSTPIIPMSQNS
HCVASTYITQHLTCPVKEVQEKIQPFFHLDLNHTIFSVPTEMRAYVKCSENNLSNKYKDE
AIILKGMGEAVFKHSCTITLPNGAKFTTPAAKTAENTANLKIFELLRVYPVPTGVIIDVG
KPQVPIINTTELTLSNARIPTKEELTYDSFHPSRSIPFLIQMACVIAFMITAILIIRCCW
PNIRAWLGRTWYCCCWGPTPEEEQKQRQEENAKTFQRLTEELDNLRLQATKGAERWKQSS
SNLWNNLQKARSLTNLKEKDSKLTNSYQQAEESLLHSEEHLPPPPPPLTPTIKHTRIVYK
ADPVNHLLDLDINDGEDTFPDLDASNKGSNNDLLQTPSPISENDVPPATQQSPTAFLTEV
LQTTKIAKKIRHSTPPEARVRIDVFVSLRNNGQKVDTIKMPKTCITQFSLNRSPNAFRNT
EFYKAIAKDARTHLALAAPFPAYTQVESPVLPVPEFRYPMFKFAKTETTCFTLKSYPSEV
EIGWLPEPHKFVEGHIISQRLYVIFECVYKSKFTYTKIKKEPEEPLTKSDGTNHDMNKRT
THLIEEAERITELLLKDSLKAKSDWMTLLYRYHVLRYRETDTSDTDNNPQTDISNHSPTS
SVTHTGHHGDTSYYAKHKYPAVYQRRTDESGIDTSGPQLVAAIRIATATRTNGHNSHDEQ
KPTLPIRERLGPMTPPPPYRETSIKTENTSGSRCVETRRHELKDRPRPRENRRAQPYRTD
RPRPEGLWRWPPTHEQQPNQHRGRERPHPSTHHRPACKRHYEDRRREDDRKRRSSTPSRS
DKGSTSTNREGPPRKMPAIDQIHHFFKEVANNPEYIKNAFAKVQHYMEKMME
Download sequence
Identical sequences E9HYU1
jgi|Dappu1|119545|fgenesh1_pg.C_scaffold_799000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]