SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|119550|fgenesh1_pg.C_scaffold_802000003 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|119550|fgenesh1_pg.C_scaffold_802000003
Domain Number 1 Region: 23-91
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.34e-18
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|119550|fgenesh1_pg.C_scaffold_802000003
Domain Number - Region: 3-29
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000403
Family Complement control module/SCR domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|119550|fgenesh1_pg.C_scaffold_802000003
Sequence length 115
Sequence
MSALTCADDGQWDEQEIPVCEPIRCSDVQVPKHGTVSGTSSILDSRITFSCQEGYQLNGE
EQITCRPDGTWSHPAVCVTRSCGDPPNIDNGFAVVRGPGVGDPISYSYQTGHRLS
Download sequence
Identical sequences E9HYU9
jgi|Dappu1|119550|fgenesh1_pg.C_scaffold_802000003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]