SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|119571|fgenesh1_pg.C_scaffold_815000004 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|119571|fgenesh1_pg.C_scaffold_815000004
Domain Number 1 Region: 108-275
Classification Level Classification E-value
Superfamily C-type lectin-like 8.92e-18
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 2 Region: 7-77
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000105
Family C-type lectin domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|119571|fgenesh1_pg.C_scaffold_815000004
Sequence length 277
Sequence
MIELLSTDYYWTSGKYSNNRWEWASTEPFQSLNYTNWFTGEPSHSQTGSFAYINFNFNNT
GLWFDEIGPTIILLICESIGGGTPTTTDATTASTTTVTTKATTETTKSTTTSTTYQPFNC
PNYLQDNFDVLCWTLGNKCYCFSQLKRDWAGANSFCRGGSMALLKIESSQENDLIYNHYL
ATPGITQDIYWTSGRYSRDGNKEWEWATAPPYAKFNYTNWSPTSTSGPQPDFCLPNGSDC
NPAYAEQFSVDIFFLFDGRWYDVVNTQAMNFICESIA
Download sequence
Identical sequences E9HYX2
jgi|Dappu1|119571|fgenesh1_pg.C_scaffold_815000004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]