SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|122404|fgenesh1_pg.C_scaffold_4237000005 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|122404|fgenesh1_pg.C_scaffold_4237000005
Domain Number 1 Region: 32-301
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.78e-26
Family NodB-like polysaccharide deacetylase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|122404|fgenesh1_pg.C_scaffold_4237000005
Sequence length 357
Sequence
MQRILVVIFFLAVFLHQSQAQCTTANCVEPACKCMNPSPPGGLSLANTPQLVFLAFDGAI
TTTNYNNYTFLLNNRINPNGCPIGMTFFIFHEYNDYSLTHSLYFKEQEISTHSMSHLTPA
ANWANKSVAEWTDEIGGIQEALAEFANIPVAGIRGARAPFLQSSGDATFTAMKNLGMFYD
CSFPTSECAIPPCPKNKYPGIWTVPMVALNRNDTVCSMADACDKPNTLDETYQYLLDNFQ
RHYTTSKAPFGIYLTANAWFQEADYRLQGYKKFLDTLSTKDDVYIVPIARGLDWMKNPKP
LAEVGNFFSCPPLTQTSCGNYTCSYEGDASPVGPRNMKSCVTCPDVYPWTGNPLGLP
Download sequence
Identical sequences E9I441
jgi|Dappu1|122404|fgenesh1_pg.C_scaffold_4237000005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]