SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|12896|gw1.1364.3.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|12896|gw1.1364.3.1
Domain Number 1 Region: 208-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000482
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 93-207
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000173
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 43-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000241
Family EGF-type module 0.02
Further Details:      
 
Domain Number 4 Region: 247-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000375
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 5 Region: 5-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000375
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|12896|gw1.1364.3.1
Sequence length 281
Sequence
FIPGFVSCSPNPCKNGASCVSNPRGESYCSCPPQYVGEYCQFANPCHTGPGPRCQNGGTC
AVKMSTNAVPSFSCSCPLGYSASLCEIPVPNACDTGPCQHGGTCLLRTLDNYTCACSSGF
RGAKCEAVDHCALHPCKNGAQCTSLSDSHRCTCAPGFAGPTCAVDIDECKRNPCIHGRCV
NTHGSYKCNCHTGYTGQNCENQYNCDSSSECDSTPCQNGGTCRPYQQGFLCTCPPGISGA
RCELDSYDECQSNPCKNNGVCRNRMGKFECHCPATWNGQQC
Download sequence
Identical sequences E9I118
jgi|Dappu1|12896|gw1.1364.3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]