SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|129960|fgenesh1_pm.C_scaffold_108000002 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|129960|fgenesh1_pm.C_scaffold_108000002
Domain Number 1 Region: 134-267
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 454-590
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000133
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 266-385
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000267
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 425-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000447
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 5 Region: 397-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|129960|fgenesh1_pm.C_scaffold_108000002
Sequence length 606
Sequence
MEIASTASIPSPANVIQATTDSCARRKSMNANPILANSAAIAKTLLAAINADASLEHRAV
IASTTSMNVSAILVVMEPLVSTESTDTLATVCQDSPGNIARLTLTNVPAILAQTECRNGA
KCTPSSNFLDFACTCELGYTGRLCDEDIDECAISSPCRNGATCQNTNGSYVCLCAKGYEG
RDCLTNTDDCATFPCKNGGTCLDGIGEYTCLCVDGFGGKHCEADMDECASSPCRNGATCR
DYVNSYTCTCPLGFSSTNCQTNDEDCTTSSCMNNGTCVDGINTYTCLCPPGYTGSNCQFR
INECDSNPCLNGATCSDRLGSYLCHCPYGFTGTRCESFVDWCSMGQPGQGPCFNGATCKQ
VNQTYQCTCAPGWTGILCDVEMVSCKDAALRKGSAVSELCRHGGKCEDIGNSHRCVCAEG
YTGSYCQHEINECDSAPCQNGATCKDLIGSHSCTCPPGFQGPNCEYNINDCYSNPCQNGG
VCHDLVNAFSCSCPHGTLGILCEINVNECFEGACHHGGACIDKIGAFECQCPPGFVGPRC
EGDVNECLSDPCSATGTLNCVQLVNNYSCHCKPGYMGRHCELKINFCEISPCNNGGMIPV
HLSARH
Download sequence
Identical sequences E9HEP9
jgi|Dappu1|129960|fgenesh1_pm.C_scaffold_108000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]