SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|1343|gw1.40.5.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|1343|gw1.40.5.1
Domain Number 1 Region: 155-224
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1e-18
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 95-166
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.2e-16
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 266-321
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000472
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 1-49
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000202
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 5 Region: 208-260
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000032
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 6 Region: 39-106
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000675
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|1343|gw1.40.5.1
Sequence length 321
Sequence
SRITFSCQEGYQLNGEEQITCRLDGTWSHPVMPVCVTRSCGDPPNIDNGFAVVRGTGVDD
TISYSCHTRQCPSVESRTCLSNGRWSEEDPACDPVVCAVPEAPEHGSCTVGGFVSGSTIR
FECKPGFTLVGSATVTCLTDKSWSDRPSNPACDPVVCAVPEAPEDGSWTVDGFVPGSTIR
FECKLGFTLVGSATVTCLTDKSWSDRTPSCQQITCPPLRDPEHGTVHYHSTAHYTCNRGY
QLFGPGQRTCTDQGTWSDRGPQYRRVWCPEPQAPLQGFVMGTGRQHGDRVRYACSTGYRL
IGADDSTCQADGTWSTVSPQC
Download sequence
Identical sequences E9GSD1
jgi|Dappu1|1343|gw1.40.5.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]