SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|17040|gw1.1856.3.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|17040|gw1.1856.3.1
Domain Number 1 Region: 34-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000628
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 120-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 76-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 4-30
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000128
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|17040|gw1.1856.3.1
Sequence length 153
Sequence
FKCRTSCIPAKYRCDGVNDCALGEDELQCRNTMTEVGCTSSQFQCKNGGCISIHFYCDGD
ADCQDRSDEPDSCPPYVCKEEGEHSCPIQHHCIPRSAVCDGNEDCNDKSDEANCTSTHSV
CSSTQFHSFKSDICIPLSWVCDRDSDCQDGEDE
Download sequence
Identical sequences E9I294
jgi|Dappu1|17040|gw1.1856.3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]