SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|18492|gw1.6017.3.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|18492|gw1.6017.3.1
Domain Number 1 Region: 35-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000122
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 120-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 76-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 3-30
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000301
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 166-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000327
Family LDL receptor-like module 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|18492|gw1.6017.3.1
Sequence length 202
Sequence
FKCQTSCIPAKYRCNGVNDCALGEDELQCRNTTTEVGCTSSQFQCKNGGCISIHFYCDGD
ADCQDKSDEPESCPSHVCLREGEYSCPNQHHCIPRSAVCDGQADCIDKSDEANCSSTHSM
CSSTQFYCSHSHICIPLTWVCDRDSDCQHGEDEDSSVCDNVVNKPLCPLNYLRCPQRPDC
MPRMALCNSIAECEHGTDAELC
Download sequence
Identical sequences E9I5G0
jgi|Dappu1|18492|gw1.6017.3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]