SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|186952|estExt_fgenesh1_pm.C_10100 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|186952|estExt_fgenesh1_pm.C_10100
Domain Number 1 Region: 495-702
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.46e-37
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 14-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-35
Family Laminin G-like module 0.00072
Further Details:      
 
Domain Number 3 Region: 242-446
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-34
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 185-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000022
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|186952|estExt_fgenesh1_pm.C_10100
Domain Number - Region: 453-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0168
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|186952|estExt_fgenesh1_pm.C_10100
Sequence length 819
Sequence
MDIPTVLVVTGVVPYFAQAPLSYMQMPTLPNAYMEFDIEISFKPESPDGLILYNGQQAGG
SGDFISFGINNGYPEFRFDIGAGPAIIKSDKPIDMGKWHTVKLTRNRKNGTMTVDEDGGT
FHGSVTGRFLGLDLIEPLYIGGVPNIRSIHKLAGFTRGFVGCVGRLVVGSAAHELVRDAT
NSRGITTCETCALNPCENGGVCQEAYTQQGYSCICPSGFSGLNCDKIGETCYPGACGMGR
CVNMAGGFDCQCPMGKSGMNCEKDIIIYEPAFTEGSFIAYPTPPKNALRKMRMSMRIKPR
QIKDSLLAYCAQTEDGSGDFSSLAIKDKRVEFRFDSGSGPAILRSDREIRAGEWVQITAD
RSFRDGVLFVNDGSEVRGKSPGSTRGLNLNSRLFVGGWDRQHVRLSPGVNVTSSFDGCLS
QFEVQGMELDLVNSVIDSANVEDCGGASACERKPCSNGGLCTETGASLTDYTCQCEEADL
CQVIRPCQNGGSCIGTYNAYKCNCPMGFGGSNCERKVDVAEEAFFQGDSYVEIDKAVFPH
TSANTAETITVEFSTLEPNGILLWHGQKPESTGRGQDFVSLTVVDGRLEFSYELGSGPVQ
IITPVRVDDGKRHRAVARRTARDGSLELDGVILENGRSPEGPHQVLNTKGNIYVGGLPNA
EAMTTGRYIHGLKGCIHHLEIQESGVINFQRAALSAINVVPCSRRMSMMSSSLVLSRGGA
GHSNSSVLEMGGNEHHQSYYTAIGDPDESGRRSKSYKGGGSSKNGKAHPNSSNSGQRDVL
KPKSRTAASSSICLRQQDPPLYRIGAALLLAVVSARLVN
Download sequence
Identical sequences E9FR27
jgi|Dappu1|186952|estExt_fgenesh1_pm.C_10100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]