SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|191866|estExt_Genewise1Plus.C_40620 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|191866|estExt_Genewise1Plus.C_40620
Domain Number 1 Region: 50-327
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.78e-29
Family NodB-like polysaccharide deacetylase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|191866|estExt_Genewise1Plus.C_40620
Sequence length 386
Sequence
MFSIKNLAILLAIFNVTHSLTLDQTNGCDSTTCILPDCLCMNTTPPMGLNLEEIPQMVFM
TFDDAVSNWMYPTYEKIFGNRTNPNGCDISMTFFVTHLGTNYQLVNEFFNRGHEIASHSV
SHKDDYPYWMNNSIAFWEREAGRQREIITTYSNIPMDQIQGFRTPYLQTGGDATFTALQN
LGINFDSSLSTKNFMDPPIWPFTMDYGVTHECMVPPCSVETHPGLWDIPVINFQSGENGT
VCNTPDFLCFPSYANLTASEVFDFFIFNYERYNKTRAPFNIYQHIYWLANSQEVLQGFLQ
FIDFLLSLDHVYFVPVSKGIEWIRNPLTLAQMTNNDVFGCDPSSNNREPVPCPEPQVCYY
PESVPGGEQNMGSCVPCPSEYPWLDV
Download sequence
Identical sequences E9FXF9
jgi|Dappu1|191866|estExt_Genewise1Plus.C_40620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]