SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|194252|estExt_Genewise1Plus.C_110391 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|194252|estExt_Genewise1Plus.C_110391
Domain Number 1 Region: 1543-1864
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.83e-37
Family Galactose oxidase, central domain 0.03
Further Details:      
 
Domain Number 2 Region: 199-509
Classification Level Classification E-value
Superfamily Kelch motif 2.09e-35
Family Kelch motif 0.025
Further Details:      
 
Domain Number 3 Region: 13-127
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-21
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 4 Region: 1445-1514,1946-2010
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000581
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 1126-1161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000943
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 1249-1298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 7 Region: 2276-2327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1121-1251
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000267
Family Growth factor receptor domain 0.0067
Further Details:      
 
Domain Number 9 Region: 1333-1445
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000301
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|194252|estExt_Genewise1Plus.C_110391
Domain Number - Region: 2195-2243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 2382-2421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00257
Family Laminin-type module 0.022
Further Details:      
 
Domain Number - Region: 130-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00854
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|194252|estExt_Genewise1Plus.C_110391
Sequence length 2888
Sequence
MVISASTTISAIHSCNRGRFVVNSTWGAITNGPENYREDSYCVWLIEAQQPGQYITLTFH
SLQTECAYDHVFVYDGDSVLSPMKGSFSGRGLPPPVIAKSGSMVVLLYSDTNYVLEGFSA
EYSVTDCPLNCSNHGHCVNHSCVCEAAFVGESCEFEACPDQCGFTESRGWCEKIDGVYQC
VCNQGYIGLDCGLDTKSSLGNSWHLLGRGNQAMQRTAHGGVYLRNLNKFIVFGGFDLNVP
LGDLLSFDMSSSKWSNLSSLAQNNESRVNVSESIQNDEPLLEVTAPKARYGHAMGALEDG
FVLYGGQFADGSLSDDFFYFDASRNEWTLLAGQSQVRPPPLTRHTLCVVNDSLIYIFGGS
MANGEFSSKLFRVQVNISELGNEEWEEVEPRGGKQHDIRLVGHSMVYHLESHSLIVYGGI
LADAARFSKLSDRLFIFNLEELHWTELLYPRGTLPDLHIPLERAFHGAVLMGSYMIVFGG
YTHKHNREEICYDSGLYFYHLGCHTWVSHHVLDHGNDGMGKDLLTPKGVFSFAAAVKDEN
VFLIFGGYRGSVSGDMLAYVVPLEMVGSRSGQSSSSNCQRHPSQLSCTANPECGWCPADG
VCYQRTSGANCTSNLQTTQCPGICPALGDCYSCTVHGNALTASNGDFVKLGQCAWCVQTA
RCHRRDDNMGVCGAGMETPSGVVGWWGSEGTDITAVDECRTRDFRPGLTYLLYEHPANFS
QPDEVGIVNSTLANFQPQSRLYSQQRDHAASAGGSGGGTMVARMLGFIHPLANKARPLND
YQQEFKIVASMTVNDTNTSRVEAVRPDKTPIFPDPSRGRKYMMEFTANRSLVGMTGSDDH
HIDTQREISRMQLVWNGKSNYRKMFTFEYVEPYSNGSCHLYTNCMQCLSDSLCGWCEPSR
NCLSRIGSNNTKSGELSECYLDAGNTTTAFLTLNPPQCINCSNHISCHQCVTDDSCEWLV
DEAYCTRRGRFAGAVQTTGECPMPCNERRGCSSCLGEPGRCTWCEETQTCFVFSSYIVVY
QFGMCREWVDSLSSVNGSRNGISAGRCKSCERKQSCSSCLIDLGCGWCYYSNNPMIGVCK
PGDFHSPAAGNCSVLLGDTPSPPSSSMTSHDPGHSVWSWAYAQCPDVDECSLGQHDCHPD
AACLNTPGSYLCACKKGYIGDGKTFCERTCFEDCVHGRCSGPPDFQCECELGWTGPDCQE
DCGCFGHSTCYQGVGTCDHCQDLTDGLSCELCRAGSYGNATTSEGCQLCQCNGHANVTAG
ICNPATGQCYCQDETEGNKCESCKPGYYGDPRHGGTCYRQCSSRGILSAITNGSLGSYSA
PDRIYRHSKNELDVQDCVWVLNTHNSVRGISGGLGGEGPKPKEAIIQLTIHQGARILCPT
NYVYVYDGLPDFMSLENGWTRQNHLLGAYCSPQTVFPLNVHAHSGIMTIFYRRNDIKQGF
NATFTVLSCPDNCPSPRKCIAGKCSCPSGWVGTDCEGQVCPNDCFSQLGHGKCDMSAGRC
LCQKGYASADCSQARRRSSIVSTELIDPQKLTEGMEHLKTVLPRLGHSLAVDHRGSLWLF
GGYSMSRGPLNDIREFETKNLTWLQVTVHIQPGVGGGESSLPPERYFHAAEYVNSQRSLY
VYGGMGNRDRASSAFLSDFWKFDINSRRWMEIGTRSLVPPLAGHTLSLRHDGEHQTLLLV
GGFSPEYGFMEKVMEFSPENGTWTVLNTTGTPPIGIYGHSAVFHVSTRSLYVYGGMLYKV
DKVVPSNELYALHFPSRRWSLLTVDRDSNPPELSMPRARYLHAAVSTEDYMLIIGGQTEP
TNSSDTLMAYSYACNTWINLAQQRNNAAELIGSPLAPAVGLAATRHPASGSVYIMGGMWA
GSAQGTLIKLEVPDDLCALWSNSKLKCKATAGCSYCAVYEPSGLNATFCYSTSKISPERC
TQPQGVLEFSKGAVCGPERVASRDCYQHASCSECLGEWPIYRGLPQSCQWCTNCKSGRCV
PYGADCQEENRCEVKQRDTVDAAQCHERSCPASDCDKCRDLGRCMWTRQLHTLPIYEWNC
VGRNIKDSSSFLVVVIPPHPCPSRCYQNNGCRECLESPGGEGGWHECRWSTALGQCVAPS
YQSLQCVGGMCGAILQGSANTACPRPCSQFTQCSTCHTQPHCGWCSLDSAPVGGIGICSR
GTLEGPLDGSCSSLDYTRVLDRLNLTAIQQHPTTWNYQSCPAENECLNGHHSCDPRSERC
LDRPDGFECLCSDGYVSEGHICRPVCSQGCVHGDCLEPNVCRCHFGFVGANCSIQCKCNG
HSECAGPEPDQLDVCLDCLNNTMGPQCTRCRPLFVGDPRNNGQCISCLEYCNGHTPVCHG
HNLSLSNLPLQTTNELLLLQTVGWSKTAEAAWVRLIGEGPKTQAVCYSCSNSTMGEKCEE
CIPGNFRGVEDRRKPCRSCECHGHGDMCHPVTGESCNCQNNTESDPQSLSGGSSGLLPAP
IPCWSLQCDKCKEYYLGTPTQGHQCYRQMSVDTEYCLDPETQEECNRKPTPLYPRRPVFF
AIQPKFLNVDIRLLVDVAQGGVDLFFAPRDDMFIVRQDPMHPGGHRVELDPKYIIITGSL
AFDQGGQPLVQHPNTSIPVERLVNNTSDRYTLSYHIVEKVASGLTTFLTVTDPFSVVVVR
GLQNRLILTLPQDRHDLRSTRFYILIQGAGSPSLDATLGSLFFRQDQPRIDLFVFFSVFF
SCFFLFLAVSVVAWKAKQAIEGRRARERQAVEMEHMARRPFATVSVYLEATLRGQTGLRD
GKRVGQNVGLQVHHTTLTAQLCSPLRWKRRSASRPDHHHSQLHHQFHGASILPDQDAVGR
LAGSNGGLQTRHIDIRPLAVEPTADGVAAIATLIVQLPGGRLARTQLTLASALVLPPRNR
SNYPTTEF
Download sequence
Identical sequences E9G6H0
jgi|Dappu1|194252|estExt_Genewise1Plus.C_110391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]